Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02645
Gene name
Locationscaffold_02:4330947..4331316
Strand-
Gene length (bp)369
Transcript length (bp)240
Coding sequence length (bp)240
Protein length (aa) 80

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05251 Ost5 Oligosaccharyltransferase subunit 5 2.8E-18 15 79

GO

GO Term Description Terminal node
GO:0034998 oligosaccharyltransferase I complex Yes
GO:0006487 protein N-linked glycosylation Yes
GO:0005575 cellular_component No
GO:1990234 transferase complex No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006486 protein glycosylation No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008250 oligosaccharyltransferase complex No
GO:0043413 macromolecule glycosylation No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0098796 membrane protein complex No
GO:0008150 biological_process No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 53 75 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 738.17 390.70 1085.64
Alive In ants, during behavior modification 593.11 302.45 883.77
Dead In ants, recently dead 393.56 184.55 602.58

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.329805 no
Alive Dead 0.030645 yes
Dead Fungus 0.002959 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02645
MDSSLHEVWQAAAGSPFLPVVGKGSQFAVGFVLLLLGLAATGVFALNRSLVNLAVVGVPASLALAFGVVYMFCAV
GVYV*
Coding >Ophcf2|02645
ATGGATTCTTCGCTTCACGAGGTCTGGCAAGCTGCTGCGGGCAGTCCGTTTCTTCCTGTCGTCGGCAAGGGAAGT
CAGTTCGCCGTCGGCTTCGTGCTGCTGCTGCTTGGGCTCGCGGCCACGGGTGTGTTTGCGTTGAATCGGTCGCTC
GTTAATCTCGCTGTCGTTGGAGTCCCTGCTTCGCTGGCGCTTGCCTTCGGTGTCGTCTACATGTTTTGCGCCGTC
GGGGTCTACGTCTGA
Transcript >Ophcf2|02645
ATGGATTCTTCGCTTCACGAGGTCTGGCAAGCTGCTGCGGGCAGTCCGTTTCTTCCTGTCGTCGGCAAGGGAAGT
CAGTTCGCCGTCGGCTTCGTGCTGCTGCTGCTTGGGCTCGCGGCCACGGGTGTGTTTGCGTTGAATCGGTCGCTC
GTTAATCTCGCTGTCGTTGGAGTCCCTGCTTCGCTGGCGCTTGCCTTCGGTGTCGTCTACATGTTTTGCGCCGTC
GGGGTCTACGTCTGA
Gene >Ophcf2|02645
ATGGATTCTTCGCTTCACGAGGTCTGGCAAGCTGCTGCGGGCAGTCCGTTTCTTCCTGTCGTCGGCAAGGGAAGT
CAGTTCGCCGTCGGCTTCGTGCTGCTGCTGCTTGGGCTCGCGGCCACGGGTGTGTTTGCGTTGAGTAAGTGATGC
TTCTGTGGTGCTTTTTATTGGATTAAGCGTTGTGGATTGTTGCTGACCTTTTTGTCGCTCAGATCGGTCGCTCGT
TAATCTCGCTGTCGTTGGAGTCCCTGCTTCGCTGGCGCTTGCGTGCGTGATACCCCTCGTCTCCCTCCTTTCCGG
CTTCGAGTTCTGACGTGCGGCAGCTTCGGTGTCGTCTACATGTTTTGCGCCGTCGGGGTCTACGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail