Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02640
Gene name
Locationscaffold_02:4277779..4286161
Strand-
Gene length (bp)8382
Transcript length (bp)7374
Coding sequence length (bp)7374
Protein length (aa) 2458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 6.9E-61 2079 2254
PF14765 PS-DH Polyketide synthase dehydratase 3.4E-52 903 1177
PF00698 Acyl_transf_1 Acyl transferase domain 3.9E-50 535 840
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.1E-43 83 263
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 4.2E-30 272 382
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 5.8E-22 387 512
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.9E-17 1923 2053
PF08242 Methyltransf_12 Methyltransferase domain 5.7E-17 1348 1454
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 2.4E-14 1878 1996
PF00106 adh_short short chain dehydrogenase 1.3E-11 2082 2236
PF13489 Methyltransf_23 Methyltransferase domain 4.7E-10 1327 1506
PF13649 Methyltransf_25 Methyltransferase domain 5.1E-08 1347 1452
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.6E-06 2088 2237
PF08241 Methyltransf_11 Methyltransferase domain 2.5E-05 1348 1455
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 3.6E-05 1758 1814
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-04 2393 2447

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5925 0.327 0.5384 0.0723 0.205 0.038 0.1213 0.1418 0.1203 0.0448

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 10 PKS

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup11
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1456
Ophiocordyceps camponoti-floridani Ophcf2|04509
Ophiocordyceps camponoti-floridani Ophcf2|05945
Ophiocordyceps camponoti-floridani Ophcf2|05210
Ophiocordyceps camponoti-floridani Ophcf2|04876
Ophiocordyceps camponoti-floridani Ophcf2|03559
Ophiocordyceps camponoti-floridani Ophcf2|02946
Ophiocordyceps camponoti-floridani Ophcf2|02940
Ophiocordyceps camponoti-floridani Ophcf2|02393
Ophiocordyceps camponoti-floridani Ophcf2|02162
Ophiocordyceps camponoti-floridani Ophcf2|01419
Ophiocordyceps camponoti-floridani Ophcf2|00877
Ophiocordyceps camponoti-floridani Ophcf2|00026
Ophiocordyceps camponoti-floridani Ophcf2|02640 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7018
Ophiocordyceps camponoti-rufipedis Ophun1|5875
Ophiocordyceps camponoti-rufipedis Ophun1|61
Ophiocordyceps camponoti-rufipedis Ophun1|7079
Ophiocordyceps camponoti-rufipedis Ophun1|2808
Ophiocordyceps camponoti-rufipedis Ophun1|7149
Ophiocordyceps camponoti-rufipedis Ophun1|7480
Ophiocordyceps camponoti-rufipedis Ophun1|5641
Ophiocordyceps camponoti-rufipedis Ophun1|7148
Ophiocordyceps camponoti-rufipedis Ophun1|5297
Ophiocordyceps camponoti-rufipedis Ophun1|839
Ophiocordyceps camponoti-rufipedis Ophun1|5181
Ophiocordyceps camponoti-rufipedis Ophun1|5180
Ophiocordyceps camponoti-rufipedis Ophun1|5123
Ophiocordyceps camponoti-rufipedis Ophun1|5085
Ophiocordyceps camponoti-rufipedis Ophun1|4013
Ophiocordyceps camponoti-rufipedis Ophun1|2837
Ophiocordyceps camponoti-rufipedis Ophun1|7483
Ophiocordyceps camponoti-rufipedis Ophun1|1461
Ophiocordyceps camponoti-rufipedis Ophun1|5183
Ophiocordyceps kimflemingae Ophio5|2713
Ophiocordyceps subramaniannii Hirsu2|2752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02640
MQVGRDGLYEYHLLRQCQPSRNPMACCPTPAAPLLRSRSPSSVWPCACLVVCAVTTTSGVFSQKEEMDFALFQGG
YFLQDVDFDQVDPTSFSGPKSELKVIDPQQRLLLEVAYECMENAGATCWQGTNIGCFVANYIDDWQDILAKDTLS
TDTYTVQGQDPMMLANRISYEYDLRGPSMTIKTGCSSALVCLDTASSYLRKGDCDGALICGSSLILSPNSMLSLD
RMGVLSPSGCGKTFDASADGFGRGEAINAIYVKTLSRAIEDGDDIRAVVRGTTVGSDGWTKAINIPSGEQHEVLM
RRAYQQAGIADLSETAFIECHGTGTSVGDPIETNAIANCVGSKGMLLTSVKPNVGHGEGAAGLTSVIKAVLALEH
RLVPPNIFFKTPNPKIPFEEAKLRVPVETENWPEGRAERVGVNSFGIGGTNAHAILESLHQYSTGQPKAHVDSNG
AHGDRDGAKPHLLLFSALSEASVMSSAKRHIDYLQNSGASAKDIAYTLAHRRDHKTYRTYAIVDGKSPPEAPASV
AVKSAPIMGWVFTGQGAQWAGMGAELIRSDAVFTRTVRRLDRFLDSLPSPPSWTIAGELGKTAAASRVLSSELSS
ALCTAVQIGLVDVLRSWNVQPDFVVGHSVGEVAAAYASGAMTAEAALAVSYFRGLSMPAKKGSMASLGLGRNQVS
PLLEPGVVVACENSQSSVTISGDAVQVDKVLRRVRNEHPGVLARLLRVETAFHSEHVHENGASYEKSMRPYIDSQ
QPETAFYSSLTGERLSNDQRLGPWYWRANMEQPVLFNSALRSALSDHRARVFMTEIGPHPALQGPINQILRGMGR
VDDVHAASLRREQGCLRSLLELAGNMFRHGVPGLRLAAVVPAGQFVRGLPSYSWARQPAPLAQPRMAREWRQHQH
APHELLGIRAWELSDEPAWRNKLSVSRSRWLIGHEIQNRIMMPAAAYISMVGEALRQLHGHTGYEVRNVTFSAAL
LLPVDGEVEMATRLRTVEASQSSAWRGFVISSYDGESWIQHCRGEARPSSSPLEASLHDTSALVRRVDADGWYEC
FRRQGLGYSGCFRGLRSITAATTEDKAMATLARQDTGVWCCVHPASIDHALQLLYLASTRGLGRKLDHLRVPTFV
GHMALHQVAEDQDSMVATARWTETGGDVVVRQDGKQLLSLRGVEMSPLSHPEEESLPLISRLDWRRHIKFCPGES
LIKQGTSFSTERALLDELVGLYCVDNVETLDLPDSHAQPHLAKLARFIKKRAQGAPSSSQLTREGRVSRMGEIYA
QGQSTAMPALFLYAKTVFDASSSVLAGSMHLLQAVLDREDDMFHEMYFRLGREANVADLIQAMAHLNPRLRVLET
GAGSGGFTRAFLDLTTTKASGERSYESYTFTDVSAPFLTSARERFAHYHGIIYDVLDLEKDPACQGFPLESYHLI
VASNVVHATRSIQKSLRHLRSLLRPGGRLLMTEPVSDFESVATYLWGPFAGWWLGEADNRPDHPLLPPEQWCKEL
VTAGFEKPDYVAGSLQATYTASRGWDQLSEMSPTSKGRVSLLCYAPDGPLVDELRVKLGSVGIAADICLFGDCMP
SSGQTVISLLDVDDRHEPVVHGMDEAAFNTLFGLFRANEKETVIWLTRPSQVGCRDPRYSMILGTARTMRTEKNA
RFYTVEVDEEQNSIAAATGLLTDLLMTPEMLGPGLDDGDADWEYAVIDGQVLIPRMHWQSLSSALVQSKGNRKDT
HESSSAVQLRIQKRGMLKSLTWEMRDVRKPSHGEVLVKTKAVGINFLDVAKSLGLVQLGGDKLGLEGSGVVVETG
PGVEGLSVGDNVLFFCDTGAFRSAVVLPDGFCTRFDDSLTFEQAASLTIIYTTVIKALVHIARLGQGQTLLLHSA
CGGVGLAAIQVARKLGAEIYCTVGTDAKRRYLTEKLSVSPTHIFGSRDPSFLGDVMRATNNRGVDVVLNSLSGEL
LQASWNCVAKGGIMVEIGKVDFQQRSNLSMERFEANRTFAGLELLSLVRENRAELRRLTDQMLEWIRQGHIQPVT
IAKVWEANQVQQAFRSMQRGDHIGKIVVRMPDDASSLASAATRCRTEPNLRPDGCYLIVGGLGGIGRAVANWLAE
NGARHLVFLSRSARQGPDVDGFVEELASQGCQARLVAGDVSILADVERAVKTAAEPIKGVVNLAMALEDAAFDNM
TFAQWTACVTPKVLGTWNLDSVLASCELDFFILTSSINGLIGGRGQANYAAASSFLDSFVQYRHSKGLVASVIDL
GLVAGIGFASRMTNLHINLGRLEPVPLMEKDVLESINLAMRSLGPSSATTGVSYAAPGQIVAGLITNSKAIRQDE
QFRKDSRLFFVHGLISATTESEPRRKTAGAAKDLITLAKQQPSLLQGDEAVKAIADDLVSAFTYMSNRDAGSVDA
GHSLAAAGLDSLLAVELRGWLWGEMGVDVPSVVITQSSSFIALAELVRDELVKRRGG*
Coding >Ophcf2|02640
ATGCAAGTCGGTAGAGACGGCCTATATGAATACCACTTGCTAAGACAATGCCAGCCATCCCGGAACCCAATGGCT
TGCTGCCCGACGCCGGCAGCACCACTGCTCCGGAGCCGATCGCCATCGTCGGTATGGCCATGCGCTTGCCTGGTG
GTGTGCGCTGTGACGACGACTTCTGGCGTCTTCTCGCAGAAGGAAGAAATGGACTTTGCCCTATTCCAAGGAGGT
TATTTCCTGCAAGACGTCGACTTCGATCAGGTTGATCCGACTTCATTCTCCGGTCCCAAGTCAGAACTTAAGGTT
ATCGACCCGCAACAAAGACTGCTGCTCGAAGTCGCCTATGAGTGCATGGAAAACGCGGGAGCAACATGTTGGCAG
GGCACCAATATTGGCTGTTTCGTAGCTAATTACATTGACGACTGGCAGGATATACTGGCCAAGGACACTCTGAGC
ACCGACACTTACACCGTACAGGGACAAGATCCCATGATGCTTGCTAACCGAATTTCGTACGAATATGACTTGCGC
GGGCCAAGTATGACTATCAAGACCGGCTGCTCGTCCGCTCTGGTCTGTCTCGACACGGCGTCCAGTTACTTGCGA
AAGGGAGATTGCGATGGTGCCCTAATCTGCGGCTCATCTCTAATTTTGTCGCCAAATTCCATGCTTTCTCTTGAC
AGAATGGGCGTACTTTCTCCCTCTGGCTGTGGCAAGACGTTTGATGCCTCGGCTGATGGCTTCGGTCGCGGCGAA
GCCATCAACGCAATCTACGTTAAGACGTTGAGCCGAGCCATTGAGGATGGCGATGACATCCGGGCCGTCGTCCGC
GGCACCACTGTGGGCAGCGATGGCTGGACCAAGGCCATCAACATTCCCAGCGGCGAGCAGCACGAAGTCTTGATG
CGTCGTGCGTACCAGCAGGCTGGCATCGCGGACCTCTCGGAAACTGCCTTCATCGAGTGCCACGGTACGGGGACC
AGCGTGGGAGATCCTATAGAGACGAATGCAATTGCGAATTGCGTCGGCTCGAAAGGGATGCTGTTGACATCGGTT
AAACCCAACGTCGGTCATGGCGAAGGCGCGGCTGGGCTCACCAGTGTCATCAAGGCCGTACTGGCTCTTGAACAC
CGTCTGGTGCCTCCAAACATATTTTTCAAGACGCCTAACCCCAAGATTCCCTTTGAAGAGGCCAAGCTCCGCGTG
CCTGTTGAGACGGAAAATTGGCCAGAAGGCCGGGCTGAAAGGGTCGGCGTCAACTCTTTCGGCATCGGCGGGACC
AACGCGCACGCCATTCTCGAGTCTCTGCACCAATATTCTACGGGCCAACCCAAGGCACATGTGGACAGTAATGGT
GCTCACGGGGACCGTGACGGCGCCAAACCTCATCTTCTGCTCTTCTCAGCCCTCAGCGAGGCGTCGGTGATGAGC
TCCGCGAAGAGGCATATCGATTATCTCCAAAATAGTGGCGCATCAGCCAAGGATATTGCTTACACTCTGGCCCAT
CGACGCGACCACAAGACATACCGGACATACGCTATAGTAGATGGCAAGAGTCCGCCCGAGGCACCGGCGTCGGTC
GCGGTTAAGTCGGCTCCGATAATGGGCTGGGTCTTTACCGGACAAGGGGCGCAGTGGGCTGGGATGGGAGCCGAG
CTGATCCGATCAGATGCTGTTTTCACACGGACTGTCAGGAGACTGGACAGGTTCCTGGATAGCTTGCCCAGCCCG
CCGTCATGGACGATCGCAGGCGAGCTTGGCAAGACTGCTGCTGCCAGTAGGGTCCTCTCTTCTGAGCTGAGCTCT
GCGTTATGCACCGCCGTTCAAATCGGGCTGGTCGACGTCCTCCGATCGTGGAACGTACAGCCCGACTTTGTGGTC
GGGCACTCGGTGGGCGAGGTAGCGGCCGCATATGCCAGCGGCGCCATGACGGCCGAGGCTGCCCTAGCAGTGAGC
TACTTCCGTGGCCTGTCGATGCCAGCGAAGAAGGGGTCTATGGCGTCCCTCGGGCTGGGAAGAAATCAGGTCTCG
CCCTTGCTGGAGCCGGGCGTCGTGGTAGCTTGTGAAAACAGCCAGTCCAGCGTCACCATCTCAGGAGATGCAGTT
CAGGTTGACAAGGTGCTTCGACGCGTACGAAATGAGCATCCCGGCGTGCTTGCGCGGCTTCTGCGTGTCGAGACG
GCCTTTCACTCGGAGCATGTACACGAAAATGGTGCTTCATACGAGAAGAGCATGCGGCCTTATATCGACAGTCAA
CAGCCCGAGACGGCGTTTTATTCCTCGCTGACGGGAGAGAGATTATCGAACGACCAACGTCTCGGGCCATGGTAC
TGGCGTGCCAACATGGAACAGCCTGTCCTCTTCAACTCGGCTCTCCGGTCAGCGCTCTCCGACCACAGGGCGAGG
GTGTTCATGACCGAGATCGGACCGCACCCGGCGCTTCAGGGGCCGATTAACCAGATCCTCAGGGGGATGGGGCGG
GTCGACGATGTGCACGCAGCCTCACTGCGGAGGGAACAGGGCTGTCTACGGAGTCTCCTCGAGCTCGCCGGCAAC
ATGTTCCGTCACGGCGTCCCGGGCCTGCGTCTCGCCGCCGTCGTCCCGGCCGGCCAGTTCGTCAGGGGCCTCCCG
TCGTACAGCTGGGCGCGGCAGCCGGCGCCCTTGGCGCAGCCCAGAATGGCGCGTGAATGGAGGCAGCACCAACAC
GCACCGCATGAGCTGCTTGGTATCAGGGCCTGGGAGCTCTCTGATGAGCCGGCCTGGAGGAATAAGCTGAGCGTC
TCGAGGTCACGCTGGCTCATCGGACATGAGATCCAGAATCGCATCATGATGCCAGCGGCGGCATACATCAGCATG
GTTGGCGAGGCCTTGCGGCAACTGCACGGACATACGGGCTACGAGGTCCGAAATGTCACCTTCTCGGCAGCGCTG
TTGCTTCCAGTCGACGGAGAGGTCGAAATGGCTACAAGGCTCCGAACAGTGGAAGCCTCCCAGTCGTCGGCATGG
CGTGGCTTCGTCATCAGTTCTTATGACGGGGAGTCTTGGATACAGCATTGCCGAGGCGAAGCGAGGCCGTCTTCG
TCGCCGCTCGAGGCATCCCTTCACGATACTTCCGCTCTGGTCCGCCGGGTCGACGCCGACGGCTGGTACGAGTGC
TTTCGTCGTCAGGGACTCGGCTATAGCGGCTGCTTCAGGGGTCTACGGTCCATTACCGCGGCCACGACCGAGGAC
AAGGCCATGGCTACGCTTGCGCGGCAGGACACGGGCGTGTGGTGTTGCGTGCACCCAGCCTCCATCGATCACGCC
TTGCAGCTGCTCTATCTGGCTTCGACTCGGGGGCTTGGCCGAAAGTTGGACCACCTGCGTGTGCCGACCTTTGTG
GGCCACATGGCGCTTCATCAAGTTGCTGAAGATCAAGACTCGATGGTCGCAACGGCTCGCTGGACCGAGACAGGC
GGAGACGTCGTTGTACGACAAGACGGCAAGCAGCTGCTGTCATTGCGTGGCGTTGAGATGTCTCCCCTTTCCCAT
CCGGAGGAAGAAAGTCTACCGCTCATATCGCGTCTGGATTGGAGACGACACATAAAGTTCTGCCCGGGCGAGTCA
CTGATCAAGCAGGGGACGTCTTTCTCAACCGAAAGGGCCTTGCTCGACGAGCTCGTCGGCTTGTACTGCGTCGAC
AATGTCGAGACGCTCGATTTACCAGACAGTCATGCCCAGCCTCACCTCGCCAAACTTGCAAGATTCATCAAGAAG
CGCGCCCAGGGAGCGCCTAGCTCGAGCCAGTTGACCCGAGAAGGGAGAGTGTCCAGGATGGGAGAAATCTACGCT
CAGGGGCAGTCGACTGCGATGCCGGCCCTGTTTCTATATGCCAAGACCGTCTTCGATGCCTCGAGCTCCGTCCTG
GCGGGCTCGATGCATCTTCTTCAGGCCGTCTTGGATCGTGAAGACGACATGTTCCACGAAATGTACTTCCGGTTG
GGTCGTGAAGCCAACGTCGCCGACTTGATACAAGCCATGGCGCACCTCAACCCCAGGCTCAGGGTTCTCGAGACT
GGCGCAGGCTCTGGCGGCTTCACTCGAGCATTTCTAGACCTGACAACCACAAAGGCCTCGGGCGAGCGATCTTAT
GAAAGCTATACCTTTACCGACGTATCAGCCCCCTTCTTGACGTCGGCGAGGGAGCGCTTCGCCCATTACCATGGC
ATCATATACGATGTATTGGACTTGGAGAAGGATCCCGCCTGCCAAGGATTCCCTCTCGAAAGCTACCATCTCATC
GTCGCGTCAAACGTCGTCCATGCCACACGGAGTATACAGAAATCGCTTCGTCATCTCAGAAGCCTGCTGAGGCCC
GGCGGCAGGTTGCTGATGACGGAACCGGTCAGCGACTTTGAGTCGGTTGCCACGTACCTGTGGGGACCCTTTGCT
GGTTGGTGGTTGGGCGAGGCCGATAACCGCCCCGACCATCCGCTGCTGCCCCCGGAGCAGTGGTGCAAAGAGTTA
GTGACGGCCGGTTTCGAGAAGCCGGATTACGTTGCCGGGAGTTTGCAAGCGACTTACACAGCCTCAAGAGGATGG
GACCAGCTGAGTGAAATGTCGCCGACCAGCAAAGGGAGGGTCAGCTTGCTCTGTTACGCTCCTGATGGGCCGCTT
GTCGACGAGCTGCGAGTGAAACTGGGGAGTGTCGGCATCGCGGCCGACATCTGCCTCTTTGGGGATTGCATGCCG
TCGAGCGGACAGACCGTCATTAGTCTGCTAGATGTGGACGATCGACACGAGCCCGTCGTCCACGGCATGGACGAG
GCGGCTTTCAATACTCTATTTGGCCTGTTTCGGGCTAACGAAAAGGAGACTGTCATTTGGCTCACGAGGCCGTCC
CAGGTCGGCTGCCGAGATCCGAGATATTCCATGATTTTGGGCACGGCTCGAACGATGAGGACGGAGAAGAACGCG
CGCTTCTATACGGTCGAGGTCGACGAAGAACAGAACAGCATTGCAGCCGCCACCGGCTTGCTGACGGACTTGTTA
ATGACTCCGGAGATGCTAGGTCCCGGCCTCGACGACGGAGACGCAGACTGGGAATATGCAGTCATCGATGGTCAA
GTTCTGATTCCCCGGATGCACTGGCAGTCGCTGTCGAGCGCGCTCGTGCAATCCAAGGGAAACAGGAAGGACACG
CATGAGTCGTCGTCGGCTGTGCAGTTGAGGATTCAGAAGAGGGGGATGCTGAAATCCTTGACATGGGAGATGAGG
GATGTTCGGAAGCCTAGTCACGGCGAGGTGCTCGTCAAGACCAAGGCAGTGGGTATCAACTTTTTGGACGTGGCC
AAATCGCTCGGTCTTGTCCAACTGGGCGGCGACAAACTCGGCTTAGAAGGCAGCGGCGTCGTCGTGGAAACAGGC
CCTGGCGTCGAGGGCTTGTCCGTCGGCGACAACGTCTTGTTCTTTTGCGATACTGGAGCCTTTCGCTCAGCCGTT
GTTTTGCCTGACGGTTTCTGTACCCGGTTCGACGACTCACTGACTTTCGAACAAGCCGCGAGCTTGACCATCATT
TACACTACCGTCATCAAGGCCTTGGTTCATATTGCGAGGCTGGGGCAAGGACAGACCCTTCTCTTGCATTCAGCA
TGTGGCGGTGTTGGCCTAGCCGCGATTCAAGTGGCCCGCAAACTCGGCGCCGAAATCTACTGCACCGTCGGCACC
GACGCCAAGCGCAGATACTTGACGGAGAAGCTCAGCGTCTCCCCGACGCACATCTTTGGCTCGCGAGACCCGTCC
TTCCTCGGCGATGTGATGCGGGCGACCAACAACAGGGGCGTCGATGTCGTGCTAAACTCCTTGTCGGGCGAGCTT
CTTCAGGCTTCGTGGAATTGCGTGGCCAAAGGCGGCATCATGGTTGAGATAGGCAAGGTCGACTTCCAGCAACGG
AGCAACTTGAGCATGGAGCGATTCGAGGCCAATCGGACCTTTGCCGGCCTCGAGCTGCTCAGCCTCGTGCGTGAG
AACAGGGCCGAACTGAGGAGACTCACGGACCAGATGCTAGAATGGATCCGGCAAGGCCACATCCAACCGGTAACG
ATCGCCAAGGTGTGGGAGGCCAACCAGGTGCAGCAGGCCTTCCGGTCCATGCAGCGTGGGGACCACATCGGTAAG
ATCGTGGTCCGGATGCCCGATGACGCGTCCAGCCTCGCGTCTGCAGCGACAAGGTGCAGAACTGAGCCGAATCTC
CGGCCGGACGGCTGTTATCTCATCGTGGGCGGCTTGGGTGGCATTGGCAGGGCCGTGGCTAACTGGCTGGCCGAG
AACGGGGCCCGGCATCTGGTGTTTCTGTCCCGGTCGGCCAGGCAGGGCCCGGACGTCGACGGCTTTGTCGAGGAG
CTGGCTTCTCAGGGCTGCCAGGCACGGCTGGTGGCGGGAGATGTCAGCATTCTGGCCGACGTTGAGAGGGCCGTC
AAGACTGCCGCGGAGCCCATCAAGGGTGTCGTGAACCTGGCCATGGCCCTCGAGGACGCCGCCTTTGACAACATG
ACGTTTGCGCAATGGACAGCATGCGTGACGCCCAAGGTGCTTGGCACGTGGAACCTCGACAGCGTCCTTGCCTCG
TGCGAACTCGACTTCTTCATCTTGACGTCGTCTATCAACGGGCTCATAGGAGGCCGAGGTCAGGCCAACTACGCG
GCCGCCTCGAGTTTTCTCGACTCTTTCGTACAGTACAGACACAGCAAGGGCCTCGTCGCGTCCGTCATCGACTTG
GGCCTCGTGGCGGGTATAGGATTCGCCTCCCGGATGACGAATTTGCACATCAATTTAGGCCGTCTTGAGCCCGTT
CCACTCATGGAGAAGGATGTACTCGAGTCTATCAACCTGGCCATGCGGTCATTGGGGCCGTCGTCAGCCACTACG
GGCGTGTCGTACGCCGCGCCGGGCCAAATTGTTGCGGGACTCATCACGAACTCAAAGGCCATCCGTCAGGACGAA
CAATTCCGCAAGGACTCTCGCCTTTTCTTTGTCCATGGTCTCATCTCGGCCACGACCGAATCAGAACCGAGACGC
AAGACGGCTGGTGCCGCCAAGGACTTGATAACTCTGGCCAAACAGCAGCCGTCCCTGCTGCAGGGGGACGAAGCC
GTCAAGGCCATAGCAGACGACCTCGTCTCCGCCTTTACATACATGTCCAATAGAGATGCTGGAAGCGTCGATGCC
GGACATTCGCTCGCTGCTGCCGGCCTCGATTCGCTCTTGGCCGTGGAACTGCGCGGCTGGTTATGGGGGGAGATG
GGCGTCGACGTGCCGTCCGTCGTCATTACTCAGAGCTCGAGTTTCATTGCGTTGGCTGAGCTTGTGCGCGACGAG
CTGGTGAAGAGGAGGGGCGGTTGA
Transcript >Ophcf2|02640
ATGCAAGTCGGTAGAGACGGCCTATATGAATACCACTTGCTAAGACAATGCCAGCCATCCCGGAACCCAATGGCT
TGCTGCCCGACGCCGGCAGCACCACTGCTCCGGAGCCGATCGCCATCGTCGGTATGGCCATGCGCTTGCCTGGTG
GTGTGCGCTGTGACGACGACTTCTGGCGTCTTCTCGCAGAAGGAAGAAATGGACTTTGCCCTATTCCAAGGAGGT
TATTTCCTGCAAGACGTCGACTTCGATCAGGTTGATCCGACTTCATTCTCCGGTCCCAAGTCAGAACTTAAGGTT
ATCGACCCGCAACAAAGACTGCTGCTCGAAGTCGCCTATGAGTGCATGGAAAACGCGGGAGCAACATGTTGGCAG
GGCACCAATATTGGCTGTTTCGTAGCTAATTACATTGACGACTGGCAGGATATACTGGCCAAGGACACTCTGAGC
ACCGACACTTACACCGTACAGGGACAAGATCCCATGATGCTTGCTAACCGAATTTCGTACGAATATGACTTGCGC
GGGCCAAGTATGACTATCAAGACCGGCTGCTCGTCCGCTCTGGTCTGTCTCGACACGGCGTCCAGTTACTTGCGA
AAGGGAGATTGCGATGGTGCCCTAATCTGCGGCTCATCTCTAATTTTGTCGCCAAATTCCATGCTTTCTCTTGAC
AGAATGGGCGTACTTTCTCCCTCTGGCTGTGGCAAGACGTTTGATGCCTCGGCTGATGGCTTCGGTCGCGGCGAA
GCCATCAACGCAATCTACGTTAAGACGTTGAGCCGAGCCATTGAGGATGGCGATGACATCCGGGCCGTCGTCCGC
GGCACCACTGTGGGCAGCGATGGCTGGACCAAGGCCATCAACATTCCCAGCGGCGAGCAGCACGAAGTCTTGATG
CGTCGTGCGTACCAGCAGGCTGGCATCGCGGACCTCTCGGAAACTGCCTTCATCGAGTGCCACGGTACGGGGACC
AGCGTGGGAGATCCTATAGAGACGAATGCAATTGCGAATTGCGTCGGCTCGAAAGGGATGCTGTTGACATCGGTT
AAACCCAACGTCGGTCATGGCGAAGGCGCGGCTGGGCTCACCAGTGTCATCAAGGCCGTACTGGCTCTTGAACAC
CGTCTGGTGCCTCCAAACATATTTTTCAAGACGCCTAACCCCAAGATTCCCTTTGAAGAGGCCAAGCTCCGCGTG
CCTGTTGAGACGGAAAATTGGCCAGAAGGCCGGGCTGAAAGGGTCGGCGTCAACTCTTTCGGCATCGGCGGGACC
AACGCGCACGCCATTCTCGAGTCTCTGCACCAATATTCTACGGGCCAACCCAAGGCACATGTGGACAGTAATGGT
GCTCACGGGGACCGTGACGGCGCCAAACCTCATCTTCTGCTCTTCTCAGCCCTCAGCGAGGCGTCGGTGATGAGC
TCCGCGAAGAGGCATATCGATTATCTCCAAAATAGTGGCGCATCAGCCAAGGATATTGCTTACACTCTGGCCCAT
CGACGCGACCACAAGACATACCGGACATACGCTATAGTAGATGGCAAGAGTCCGCCCGAGGCACCGGCGTCGGTC
GCGGTTAAGTCGGCTCCGATAATGGGCTGGGTCTTTACCGGACAAGGGGCGCAGTGGGCTGGGATGGGAGCCGAG
CTGATCCGATCAGATGCTGTTTTCACACGGACTGTCAGGAGACTGGACAGGTTCCTGGATAGCTTGCCCAGCCCG
CCGTCATGGACGATCGCAGGCGAGCTTGGCAAGACTGCTGCTGCCAGTAGGGTCCTCTCTTCTGAGCTGAGCTCT
GCGTTATGCACCGCCGTTCAAATCGGGCTGGTCGACGTCCTCCGATCGTGGAACGTACAGCCCGACTTTGTGGTC
GGGCACTCGGTGGGCGAGGTAGCGGCCGCATATGCCAGCGGCGCCATGACGGCCGAGGCTGCCCTAGCAGTGAGC
TACTTCCGTGGCCTGTCGATGCCAGCGAAGAAGGGGTCTATGGCGTCCCTCGGGCTGGGAAGAAATCAGGTCTCG
CCCTTGCTGGAGCCGGGCGTCGTGGTAGCTTGTGAAAACAGCCAGTCCAGCGTCACCATCTCAGGAGATGCAGTT
CAGGTTGACAAGGTGCTTCGACGCGTACGAAATGAGCATCCCGGCGTGCTTGCGCGGCTTCTGCGTGTCGAGACG
GCCTTTCACTCGGAGCATGTACACGAAAATGGTGCTTCATACGAGAAGAGCATGCGGCCTTATATCGACAGTCAA
CAGCCCGAGACGGCGTTTTATTCCTCGCTGACGGGAGAGAGATTATCGAACGACCAACGTCTCGGGCCATGGTAC
TGGCGTGCCAACATGGAACAGCCTGTCCTCTTCAACTCGGCTCTCCGGTCAGCGCTCTCCGACCACAGGGCGAGG
GTGTTCATGACCGAGATCGGACCGCACCCGGCGCTTCAGGGGCCGATTAACCAGATCCTCAGGGGGATGGGGCGG
GTCGACGATGTGCACGCAGCCTCACTGCGGAGGGAACAGGGCTGTCTACGGAGTCTCCTCGAGCTCGCCGGCAAC
ATGTTCCGTCACGGCGTCCCGGGCCTGCGTCTCGCCGCCGTCGTCCCGGCCGGCCAGTTCGTCAGGGGCCTCCCG
TCGTACAGCTGGGCGCGGCAGCCGGCGCCCTTGGCGCAGCCCAGAATGGCGCGTGAATGGAGGCAGCACCAACAC
GCACCGCATGAGCTGCTTGGTATCAGGGCCTGGGAGCTCTCTGATGAGCCGGCCTGGAGGAATAAGCTGAGCGTC
TCGAGGTCACGCTGGCTCATCGGACATGAGATCCAGAATCGCATCATGATGCCAGCGGCGGCATACATCAGCATG
GTTGGCGAGGCCTTGCGGCAACTGCACGGACATACGGGCTACGAGGTCCGAAATGTCACCTTCTCGGCAGCGCTG
TTGCTTCCAGTCGACGGAGAGGTCGAAATGGCTACAAGGCTCCGAACAGTGGAAGCCTCCCAGTCGTCGGCATGG
CGTGGCTTCGTCATCAGTTCTTATGACGGGGAGTCTTGGATACAGCATTGCCGAGGCGAAGCGAGGCCGTCTTCG
TCGCCGCTCGAGGCATCCCTTCACGATACTTCCGCTCTGGTCCGCCGGGTCGACGCCGACGGCTGGTACGAGTGC
TTTCGTCGTCAGGGACTCGGCTATAGCGGCTGCTTCAGGGGTCTACGGTCCATTACCGCGGCCACGACCGAGGAC
AAGGCCATGGCTACGCTTGCGCGGCAGGACACGGGCGTGTGGTGTTGCGTGCACCCAGCCTCCATCGATCACGCC
TTGCAGCTGCTCTATCTGGCTTCGACTCGGGGGCTTGGCCGAAAGTTGGACCACCTGCGTGTGCCGACCTTTGTG
GGCCACATGGCGCTTCATCAAGTTGCTGAAGATCAAGACTCGATGGTCGCAACGGCTCGCTGGACCGAGACAGGC
GGAGACGTCGTTGTACGACAAGACGGCAAGCAGCTGCTGTCATTGCGTGGCGTTGAGATGTCTCCCCTTTCCCAT
CCGGAGGAAGAAAGTCTACCGCTCATATCGCGTCTGGATTGGAGACGACACATAAAGTTCTGCCCGGGCGAGTCA
CTGATCAAGCAGGGGACGTCTTTCTCAACCGAAAGGGCCTTGCTCGACGAGCTCGTCGGCTTGTACTGCGTCGAC
AATGTCGAGACGCTCGATTTACCAGACAGTCATGCCCAGCCTCACCTCGCCAAACTTGCAAGATTCATCAAGAAG
CGCGCCCAGGGAGCGCCTAGCTCGAGCCAGTTGACCCGAGAAGGGAGAGTGTCCAGGATGGGAGAAATCTACGCT
CAGGGGCAGTCGACTGCGATGCCGGCCCTGTTTCTATATGCCAAGACCGTCTTCGATGCCTCGAGCTCCGTCCTG
GCGGGCTCGATGCATCTTCTTCAGGCCGTCTTGGATCGTGAAGACGACATGTTCCACGAAATGTACTTCCGGTTG
GGTCGTGAAGCCAACGTCGCCGACTTGATACAAGCCATGGCGCACCTCAACCCCAGGCTCAGGGTTCTCGAGACT
GGCGCAGGCTCTGGCGGCTTCACTCGAGCATTTCTAGACCTGACAACCACAAAGGCCTCGGGCGAGCGATCTTAT
GAAAGCTATACCTTTACCGACGTATCAGCCCCCTTCTTGACGTCGGCGAGGGAGCGCTTCGCCCATTACCATGGC
ATCATATACGATGTATTGGACTTGGAGAAGGATCCCGCCTGCCAAGGATTCCCTCTCGAAAGCTACCATCTCATC
GTCGCGTCAAACGTCGTCCATGCCACACGGAGTATACAGAAATCGCTTCGTCATCTCAGAAGCCTGCTGAGGCCC
GGCGGCAGGTTGCTGATGACGGAACCGGTCAGCGACTTTGAGTCGGTTGCCACGTACCTGTGGGGACCCTTTGCT
GGTTGGTGGTTGGGCGAGGCCGATAACCGCCCCGACCATCCGCTGCTGCCCCCGGAGCAGTGGTGCAAAGAGTTA
GTGACGGCCGGTTTCGAGAAGCCGGATTACGTTGCCGGGAGTTTGCAAGCGACTTACACAGCCTCAAGAGGATGG
GACCAGCTGAGTGAAATGTCGCCGACCAGCAAAGGGAGGGTCAGCTTGCTCTGTTACGCTCCTGATGGGCCGCTT
GTCGACGAGCTGCGAGTGAAACTGGGGAGTGTCGGCATCGCGGCCGACATCTGCCTCTTTGGGGATTGCATGCCG
TCGAGCGGACAGACCGTCATTAGTCTGCTAGATGTGGACGATCGACACGAGCCCGTCGTCCACGGCATGGACGAG
GCGGCTTTCAATACTCTATTTGGCCTGTTTCGGGCTAACGAAAAGGAGACTGTCATTTGGCTCACGAGGCCGTCC
CAGGTCGGCTGCCGAGATCCGAGATATTCCATGATTTTGGGCACGGCTCGAACGATGAGGACGGAGAAGAACGCG
CGCTTCTATACGGTCGAGGTCGACGAAGAACAGAACAGCATTGCAGCCGCCACCGGCTTGCTGACGGACTTGTTA
ATGACTCCGGAGATGCTAGGTCCCGGCCTCGACGACGGAGACGCAGACTGGGAATATGCAGTCATCGATGGTCAA
GTTCTGATTCCCCGGATGCACTGGCAGTCGCTGTCGAGCGCGCTCGTGCAATCCAAGGGAAACAGGAAGGACACG
CATGAGTCGTCGTCGGCTGTGCAGTTGAGGATTCAGAAGAGGGGGATGCTGAAATCCTTGACATGGGAGATGAGG
GATGTTCGGAAGCCTAGTCACGGCGAGGTGCTCGTCAAGACCAAGGCAGTGGGTATCAACTTTTTGGACGTGGCC
AAATCGCTCGGTCTTGTCCAACTGGGCGGCGACAAACTCGGCTTAGAAGGCAGCGGCGTCGTCGTGGAAACAGGC
CCTGGCGTCGAGGGCTTGTCCGTCGGCGACAACGTCTTGTTCTTTTGCGATACTGGAGCCTTTCGCTCAGCCGTT
GTTTTGCCTGACGGTTTCTGTACCCGGTTCGACGACTCACTGACTTTCGAACAAGCCGCGAGCTTGACCATCATT
TACACTACCGTCATCAAGGCCTTGGTTCATATTGCGAGGCTGGGGCAAGGACAGACCCTTCTCTTGCATTCAGCA
TGTGGCGGTGTTGGCCTAGCCGCGATTCAAGTGGCCCGCAAACTCGGCGCCGAAATCTACTGCACCGTCGGCACC
GACGCCAAGCGCAGATACTTGACGGAGAAGCTCAGCGTCTCCCCGACGCACATCTTTGGCTCGCGAGACCCGTCC
TTCCTCGGCGATGTGATGCGGGCGACCAACAACAGGGGCGTCGATGTCGTGCTAAACTCCTTGTCGGGCGAGCTT
CTTCAGGCTTCGTGGAATTGCGTGGCCAAAGGCGGCATCATGGTTGAGATAGGCAAGGTCGACTTCCAGCAACGG
AGCAACTTGAGCATGGAGCGATTCGAGGCCAATCGGACCTTTGCCGGCCTCGAGCTGCTCAGCCTCGTGCGTGAG
AACAGGGCCGAACTGAGGAGACTCACGGACCAGATGCTAGAATGGATCCGGCAAGGCCACATCCAACCGGTAACG
ATCGCCAAGGTGTGGGAGGCCAACCAGGTGCAGCAGGCCTTCCGGTCCATGCAGCGTGGGGACCACATCGGTAAG
ATCGTGGTCCGGATGCCCGATGACGCGTCCAGCCTCGCGTCTGCAGCGACAAGGTGCAGAACTGAGCCGAATCTC
CGGCCGGACGGCTGTTATCTCATCGTGGGCGGCTTGGGTGGCATTGGCAGGGCCGTGGCTAACTGGCTGGCCGAG
AACGGGGCCCGGCATCTGGTGTTTCTGTCCCGGTCGGCCAGGCAGGGCCCGGACGTCGACGGCTTTGTCGAGGAG
CTGGCTTCTCAGGGCTGCCAGGCACGGCTGGTGGCGGGAGATGTCAGCATTCTGGCCGACGTTGAGAGGGCCGTC
AAGACTGCCGCGGAGCCCATCAAGGGTGTCGTGAACCTGGCCATGGCCCTCGAGGACGCCGCCTTTGACAACATG
ACGTTTGCGCAATGGACAGCATGCGTGACGCCCAAGGTGCTTGGCACGTGGAACCTCGACAGCGTCCTTGCCTCG
TGCGAACTCGACTTCTTCATCTTGACGTCGTCTATCAACGGGCTCATAGGAGGCCGAGGTCAGGCCAACTACGCG
GCCGCCTCGAGTTTTCTCGACTCTTTCGTACAGTACAGACACAGCAAGGGCCTCGTCGCGTCCGTCATCGACTTG
GGCCTCGTGGCGGGTATAGGATTCGCCTCCCGGATGACGAATTTGCACATCAATTTAGGCCGTCTTGAGCCCGTT
CCACTCATGGAGAAGGATGTACTCGAGTCTATCAACCTGGCCATGCGGTCATTGGGGCCGTCGTCAGCCACTACG
GGCGTGTCGTACGCCGCGCCGGGCCAAATTGTTGCGGGACTCATCACGAACTCAAAGGCCATCCGTCAGGACGAA
CAATTCCGCAAGGACTCTCGCCTTTTCTTTGTCCATGGTCTCATCTCGGCCACGACCGAATCAGAACCGAGACGC
AAGACGGCTGGTGCCGCCAAGGACTTGATAACTCTGGCCAAACAGCAGCCGTCCCTGCTGCAGGGGGACGAAGCC
GTCAAGGCCATAGCAGACGACCTCGTCTCCGCCTTTACATACATGTCCAATAGAGATGCTGGAAGCGTCGATGCC
GGACATTCGCTCGCTGCTGCCGGCCTCGATTCGCTCTTGGCCGTGGAACTGCGCGGCTGGTTATGGGGGGAGATG
GGCGTCGACGTGCCGTCCGTCGTCATTACTCAGAGCTCGAGTTTCATTGCGTTGGCTGAGCTTGTGCGCGACGAG
CTGGTGAAGAGGAGGGGCGGTTGA
Gene >Ophcf2|02640
ATGCAAGTCGGTAGAGACGGCCTATATGAATACCAGTATGCCTCTTCGTTGTGTCCCGAAAGCGGGCCTTTCTTC
CAGTCTGCTTGACAGCTATCGGTCACATCGATTACTCTGACCGTTTTTCAACAAGCTTGCTAAGACAATGCCAGC
CATCCCGGAACCCAATGGCTTGCTGCCCGACGCCGGCAGCACCACTGCTCCGGAGCCGATCGCCATCGTCGGTAT
GGCCATGCGCTTGCCTGGTGGTGTGCGCTGTGACGACGACTTCTGGCGTCTTCTCGCAGAAGGAAGAAATGGACT
TTGCCCTATTCCAAGGAGTAGATTCAACGTGGAAGGATTTCATGGCAGTCTAGGTCAGGCCGGCTCACTTTTAGT
GCATCAGGGTTATTTCCTGCAAGACGTCGACTTCGATCAGGTTGATCCGACTTCATTCTCCGGTCCCAAGTCAGA
ACTTAAGGTTATCGACCCGCAACAAAGACTGCTGCTCGAAGTCGCCTATGAGTGCATGGAAAACGCGGGAGCAAC
ATGTTGGCAGGGCACCAATATTGGCTGTTTCGTAGCTAATTACATTGACGACTGGCAGGATATACTGGCCAAGGA
CACTCTGAGCACCGACACTTACACCGTACAGGGACAAGATCCCATGATGCTTGCTAACCGAATTTCGTACGAATA
TGACTTGCGCGGGCCAAGGTTGGTTGATCCGGCTGATAAACTGTATGTATTTTGCTGAGCTATATTAGTATGACT
ATCAAGACCGGCTGCTCGTCCGCTCTGGTCTGTCTCGACACGGCGTCCAGTTACTTGCGAAAGGGAGATTGCGAT
GGTGCCCTAATCTGCGGCTCATCTCTAATTTTGTCGCCAAATTCCATGCTTTCTCTTGACAGAATGGGCGTACTT
TCTCCCTCTGGCTGTGGCAAGACGTTTGATGCCTCGGCTGATGGCTTCGGTCGCGGCGAAGCCATCAACGCAATC
TACGTTAAGACGTTGAGCCGAGCCATTGAGGATGGCGATGACATCCGGGCCGTCGTCCGCGGCACCACTGTGGGC
AGCGATGGCTGGACCAAGGCCATCAACATTCCCAGCGGCGAGCAGCACGAAGTCTTGATGCGTCGTGCGTACCAG
CAGGCTGGCATCGCGGACCTCTCGGAAACTGCCTTCATCGAGTGCCACGGTACGGGGACCAGCGTGGGAGATCCT
ATAGAGACGAATGCAATTGCGAATTGCGTCGGCTCGAAAGGGATGCTGTTGACATCGGTAAGAGACACTGAGTCA
AGGTTGATCCGTTTTTGATTAAATGGTTTCAATATTAGGTTAAACCCAACGTCGGTCATGGCGAAGGCGCGGCTG
GGCTCACCAGTGTCATCAAGGCCGTACTGGCTCTTGAACACCGTCTGGTGCCTCCAAACATATTTTTCAAGACGC
CTAACCCCAAGAGTGAGTCTGCCGTGGTTGACACTGGTTGCTTATGGTTGACGGCTGGGTGTACAGTTCCCTTTG
AAGAGGCCAAGCTCCGCGTGCCTGTTGAGACGGAAAATTGGCCAGAAGGCCGGGCTGAAAGGGTCGGCGTCAACT
CTTTCGGCATCGGCGGGACCAACGCGCACGTAAGAGTATTCGAGCATGGCCATATCGAGAAGAGCTCGCTGACCA
TGACCTCAAGGCCATTCTCGAGTCTCTGCACCAATATTCTACGGGCCAACCCAAGGCACATGTGGACAGTAATGG
TGCTCACGGGGACCGTGACGGCGCCAAACCTCATCTTCTGCTCTTCTCAGCCCTCAGCGAGGCGTCGGTGATGAG
CTCCGCGAAGAGGCATATCGATTATCTCCAAAATAGTGGCGCATCAGCCAAGGATATTGCTTACACTCTGGCCCA
TCGACGCGACCACAAGACATACCGGACATACGCTATAGTAGATGGCAAGAGTCCGCCCGAGGCACCGGCGTCGGT
CGCGGTTAAGTCGGCTCCGATAATGGGCTGGGTCTTTACCGGACAAGGGGCGCAGTGGGCTGGGATGGGAGCCGA
GCTGATCCGATCAGATGCTGTTTTCACACGGACTGTCAGGAGACTGGACAGGTTCCTGGATAGCTTGCCCAGCCC
GCCGTCATGGACGATCGCAGGTAATGCGGCTCCAATTCCCCATCTTCTTCAACCAACAACTGACTCTGGCTGGAA
GGCGAGCTTGGCAAGACTGCTGCTGCCAGTAGGGTCCTCTCTTCTGAGCTGAGCTCTGCGTTATGCACCGCCGTT
CAAATCGGGCTGGTCGACGTCCTCCGATCGTGGAACGTACAGCCCGACTTTGTGGTCGGGCACTCGGTGGGCGAG
GTAGCGGCCGCATATGCCAGCGGCGCCATGACGGCCGAGGCTGCCCTAGCAGTGAGCTACTTCCGTGGCCTGTCG
ATGCCAGCGAAGAAGGGGTCTATGGCGTCCCTCGGGCTGGGAAGAAATCAGGTCTCGCCCTTGCTGGAGCCGGGC
GTCGTGGTAGCTTGTGAAAACAGCCAGTCCAGCGTCACCATCTCAGGAGATGCAGTTCAGGTTGACAAGGTGCTT
CGACGCGTACGAAATGAGCATCCCGGCGTGCTTGCGCGGCTTCTGCGTGTCGAGACGGCCTTTCACTCGGGTAAG
ATGTCAAGTGGCGGAAGACGGACGAGCTGGGAGCTGACAAGTCGGCCGAGAAGAGCATGTACACGAAAATGGTGC
TTCATACGAGAAGAGCATGCGGCCTTATATCGACAGTCAACAGCCCGAGACGGCGTTTTATTCCTCGCTGACGGG
AGAGAGATTATCGAACGACCAACGTCTCGGGCCATGGTACTGGCGTGCCAACATGGAACAGCCTGTCCTCTTCAA
CTCGGCTCTCCGGTCAGCGCTCTCCGACCACAGGGCGAGGGTGTTCATGACCGAGATCGGACCGCACCCGGCGCT
TCAGGGGCCGATTAACCAGATCCTCAGGGGGATGGGGCGGGTCGACGATGTGCACGCAGCCTCACTGCGGAGGGA
ACAGGGCTGTCTACGGAGTCTCCTCGAGCTCGCCGGCAACATGTTCCGTCACGGCGTCCCGGGCCTGCGTCTCGC
CGCCGTCGTCCCGGCCGGCCAGTTCGTCAGGGGCCTCCCGTCGTACAGCTGGGCGCGGCAGCCGGCGCCCTTGGC
GCAGCCCAGAATGGCGCGTGAATGGAGGCAGCACCAACACGCACCGCATGAGCTGCTTGGTATCAGGGCCTGGGA
GCTCTCTGATGAGCCGGCCTGGAGGAATAAGCTGAGCGTCTCGAGGTCACGCTGGCTCATCGGACATGAGATCCA
GAATCGCATCATGATGCCAGCGGCGGCATACATCAGCATGGTTGGCGAGGCCTTGCGGCAACTGCACGGACATAC
GGGCTACGAGGTCCGAAATGTCACCTTCTCGGCAGCGCTGTTGCTTCCAGTCGACGGAGAGGTCGAAATGGCTAC
AAGGCTCCGAACAGTGGAAGCCTCCCAGTCGTCGGCATGGCGTGGCTTCGTCATCAGTTCTTATGACGGGGAGTC
TTGGATACAGCATTGCCGAGGCGAAGCGAGGCCGTCTTCGTCGCCGCTCGAGGCATCCCTTCACGATACTTCCGC
TCTGGTCCGCCGGGTCGACGCCGACGGCTGGTACGAGTGCTTTCGTCGTCAGGGACTCGGCTATAGCGGCTGCTT
CAGGGGTCTACGGTCCATTACCGCGGCCACGACCGAGGACAAGGCCATGGCTACGCTTGCGCGGCAGGACACGGG
CGTGTGGTGTTGCGTGCACCCAGCCTCCATCGATCACGCCTTGCAGCTGCTCTATCTGGCTTCGACTCGGGGGCT
TGGCCGAAAGTTGGACCACCTGCGTGTGCCGACCTTTGTGGGCCACATGGCGCTTCATCAAGTTGCTGAAGATCA
AGACTCGATGGTCGCAACGGCTCGCTGGACCGAGACAGGCGGAGACGTCGTTGTACGACAAGACGGCAAGCAGCT
GCTGTCATTGCGTGGCGTTGAGATGTCTCCCCTTTCCCATCCGGAGGAAGAAAGTCTACCGCTCATATCGCGTCT
GGATTGGAGACGACACATAAAGTTCTGCCCGGGCGAGTCACTGATCAAGCAGGGGACGTCTTTCTCAACCGAAAG
GGCCTTGCTCGACGAGCTCGTCGGCTTGTACTGCGTCGACAATGTCGAGACGCTCGATTTACCAGACAGTCATGC
CCAGCCTCACCTCGCCAAACTTGCAAGATTCATCAAGAAGCGCGCCCAGGGAGCGCCTAGCTCGAGCCAGTTGAC
CCGAGAAGGGAGAGTGTCCAGGATGGGAGAAATCTACGCTCAGGGGCAGTCGACTGCGATGCCGGCCCTGTTTCT
ATATGCCAAGACCGTCTTCGATGCCTCGAGCTCCGTCCTGGCGGGCTCGATGCATCTTCTTCAGGCCGTCTTGGA
TCGTGAAGACGACATGTTCCACGAAATGTACTTCCGGTTGGGTCGTGAAGCCAACGTCGCCGACTTGATACAAGC
CATGGCGCACCTCAACCCCAGGCTCAGGGTTCTCGAGACTGGCGCAGGCTCTGGCGGCTTCACTCGAGCATTTCT
AGACCTGACAACCACAAAGGCCTCGGGCGAGCGATCTTATGAAAGCTATACCTTTACCGACGTATCAGCCCCCTT
CTTGACGTCGGCGAGGGAGCGCTTCGCCCATTACCATGGCATCATATACGATGTATTGGACTTGGAGAAGGATCC
CGCCTGCCAAGGATTCCCTCTCGAAAGCTACCATCTCATCGTCGCGTCAAACGTACGCTGCTCCTTGCGACTCCT
TTTCCATCGTTTGACTGACGAGGGGCTTTGCTACAGGTCGTCCATGCCACACGGAGTATACAGAAATCGCTTCGT
CATCTCAGAAGCCTGCTGAGGCCCGGCGGCAGGTTGCTGATGACGGAACCGGTCAGCGGTCAGTACTTCCCACGC
CTGATCACCCATGACAGACAATACTCGTGATGCTGAAACTTGATCAGACTTTGAGTCGGTTGCCACGTACCTGTG
GGTAAGTACATACCTGGTTCTCGGCCTGCGCGTTCTCTCGGTCTAAGTCATTCTTCCTGCTAGGGACCCTTTGCT
GGTTGGTGGTTGGGCGAGGCCGATAACCGCCCCGACCATCCGCTGCTGCCCCCGGAGCAGTGGTGCAAAGAGTTA
GTGACGGCCGGTTTCGAGAAGCCGGATTACGTTGCCGGGAGTTTGCAAGCGACTTACACAGCCTCAAGAGGATGG
GACCAGCTGAGTGAAATGTCGCCGACCAGCAAAGGGAGGGTCAGCTTGCTCTGTTACGCTCCTGATGGGCCGCTT
GTCGACGAGCTGCGAGTGAAACTGGGGAGTGTCGGCATCGCGGCCGACATCTGCCTCTTTGGGGATTGCATGCCG
TCGAGCGGACAGACCGTCATTAGTCTGCTAGATGTGGACGATCGACACGAGCCCGTCGTCCACGGCATGGACGAG
GCGGCTTTCAATACTCTATTTGGCCTGTTTCGGGCTAACGAAAAGGAGACTGTCATTTGGCTCACGAGGCCGTCC
CAGGTCGGCTGCCGAGATCCGAGATATTCCATGATTTTGGGCACGGCTCGAACGATGAGGACGGAGAAGAACGCG
CGCTTCTATACGGTCGAGGTCGACGAAGAACAGAACAGCATTGCAGCCGCCACCGGCTTGCTGACGGACTTGTTA
ATGACTCCGGAGATGCTAGGTCCCGGCCTCGACGACGGAGACGCAGACTGGGAATATGCAGTCATCGATGGTCAA
GTTCTGATTCCCCGGATGCACTGGCAGTCGCTGTCGAGCGCGCTCGTGCAATCCAAGGGAAACAGGAAGGACACG
CATGAGTCGTCGTCGGCTGTGCAGTTGAGGATTCAGAAGAGGGGGATGCTGAAATCCTTGACATGGGAGATGAGG
GATGTTCGGAAGCCTAGTCACGGCGAGGTGCTCGTCAAGACCAAGGCAGTGGGTATCAACTTTTTGGTATGGCTT
GCGTCCTTTTCTGCAAAACCAGTTCGAAACTGACGGTTACAGGACGTGGCCAAATCGCTCGGTCTTGTCCAACTG
GGCGGCGACAAACTCGGCTTAGAAGGCAGCGGCGTCGTCGTGGAAACAGGCCCTGGCGTCGAGGGCTTGTCCGTC
GGCGACAACGTCTTGTTCTTTTGCGATACTGGAGCCTTTCGCTCAGCCGTTGTTTTGCCTGACGGTTTCTGTACC
CGGTTCGACGACTCACTGACTTTCGAACAAGCCGCGAGCTTGACCATCATTTACACTACCGTCATCAAGGCCTTG
GTTCATATTGCGAGGCTGGGGCAAGGACAGGTAAGCTCGGCGGCGACTTGAAGTGGGTTATTGAGTGCTGCTGAC
TTCTTGACCGCGTCGACAGACCCTTCTCTTGCATTCAGCATGTGGCGGTGTTGGCCTAGCCGCGATTCAAGTGGC
CCGCAAACTCGGCGCCGAAGTGAGACGCCTTTTAATCTATCTTTAAGGGGGGGAGGGGGGGGTGGGAAGAAAGGC
TGTTTGAAGAACGGTAGAGGCTGACGTCGTGGGCCACCAGATCTACTGCACCGTCGGCACCGACGCCAAGCGCAG
ATACTTGACGGAGAAGCTCAGCGTCTCCCCGACGCACATCTTTGGCTCGCGAGACCCGTCCTTCCTCGGCGATGT
GATGCGGGCGACCAACAACAGGGGCGTCGATGTCGTGCTAAACTCCTTGTCGGGCGAGCTTCTTCAGGCTTCGTG
GAATTGCGTGGCCAAAGGCGGCATCATGGTTGAGATAGGCAAGGTCGACTTCCAGCAACGGAGCAACTTGAGCAT
GGAGCGATTCGAGGCCAATCGGACCTTTGCCGGCCTCGAGCTGCTCAGCCTCGTGCGTGAGAACAGGGCCGAACT
GAGGAGGTGAGTCCCTCGTGCCGGAAGCGGCAGAACGTATTGACCTTTCTCTGACACGACGAAAAGACTCACGGA
CCAGATGCTAGAATGGATCCGGCAAGGCCACATCCAACCGGTAACGATCGCCAAGGTGTGGGAGGCCAACCAGGT
GCAGCAGGCCTTCCGGTCCATGCAGCGTGGGGACCACATCGGTAAGATCGTGGTCCGGATGCCCGATGACGCGTC
CAGCCTCGCGTCTGCAGCGACAAGGTGCAGAACTGAGCCGAATCTCCGGCCGGACGGCTGTTATCTCATCGTGGG
CGGCTTGGGTGGCATTGGCAGGGCCGTGGCTAACTGGCTGGCCGAGAACGGGGCCCGGCATCTGGTGTTTCTGTC
CCGGTCGGCCAGGCAGGGCCCGGACGTCGACGGCTTTGTCGAGGAGCTGGCTTCTCAGGGCTGCCAGGCACGGCT
GGTGGCGGGAGATGTCAGCATTCTGGCCGACGTTGAGAGGGCCGTCAAGACTGCCGCGGAGCCCATCAAGGGTGT
CGTGAACCTGGCCATGGCCCTCGAGGTGAGTATCGTTGCCTCTATCGTGCTCCTCTAGACACGCCTCTGACGTGC
TCTCCGCTCAAGGACGCCGCCTTTGACAACATGACGTTTGCGCAATGGACAGCATGCGTGACGCCCAAGGTGCTT
GGCACGTGGAACCTCGACAGCGTCCTTGCCTCGTGCGAACTCGACTTCTTCATCTTGACGTCGTCTATCAACGGG
CTCATAGGAGGCCGAGGTCAGGCCAACTACGCGGCCGCCTCGAGTTTTCTCGACTCTTTCGTACAGTACAGACAC
AGCAAGGGCCTCGTCGCGTCCGTCATCGACTTGGGCCTCGTGGCGGGTATAGGATTCGCCTCCCGGATGACGAAT
TTGCACATCAATTTAGGCCGTCTTGAGCCCGTTCCACTCATGGAGAAGGATGTACTCGAGTCTATCAACCTGGCC
ATGCGGTCATTGGGGCCGTCGTCAGCCACTACGGGCGTGTCGTACGCCGCGCCGGGCCAAATTGTTGCGGGACTC
ATCACGAACTCAAAGGCCATCCGTCAGGACGAACAATTCCGCAAGGACTCTCGCCTTTTCTTTGTCCATGGTCTC
ATCTCGGCCACGACCGAATCAGAACCGAGACGCAAGACGGCTGGTGCCGCCAAGGACTTGATAACTCTGGCCAAA
CAGCAGCCGTCCCTGCTGCAGGGGGACGAAGCCGTCAAGGCCATAGCAGACGACCTCGTCTCCGCCTTTACATAC
ATGTCCAATAGAGATGCTGGAAGCGTCGATGCCGGACATTCGCTCGCTGCTGCCGGCCTCGATTCGCTCTTGGCC
GTGGAACTGCGCGGCTGGTTATGGGGGGAGATGGGCGTCGACGTGCCGTCCGTCGTCATTACTCAGAGCTCGAGT
TTCATTGCGTTGGCTGAGCTTGTGCGCGACGAGCTGGTGAAGAGGAGGGGCGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail