Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02633
Gene name
Locationscaffold_02:4252841..4254050
Strand+
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19189 Mtf2 Mtf2 family 2.6E-21 185 358

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1333 0.1684 0.0847 0.0601 0.9339 0.0102 0.0339 0.0416 0.0758 0.009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3689
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1115
Ophiocordyceps australis map64 (Brazil) OphauB2|1600
Ophiocordyceps camponoti-floridani Ophcf2|02633 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6992
Ophiocordyceps kimflemingae Ophio5|3363
Ophiocordyceps subramaniannii Hirsu2|7150

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02633
MLSSVSPARARWRILACPVISRLSRRAHTDIERKHDNAIPFDWGDNSHFGEQDNGGSEGSTITPSEAYIFKSIFE
EIATGRMPPSKKRSFQGEGTRGEHDGSFRKHRGGPARSIVEQARITEFREKFLCRYPQSLQVAAKMALRMFETDP
STADNTTKVTEVDKKKLEEAAEYEAARTEERVRVEALMKGCATDVALWKVMEDEVFSLPSKLGIVPAKKRIRSPR
RSANAGEPAIDARKPTESESIAKAPDSQKLSMDIHGPLYPHFLEQGLDSFDTAFVRSSPYALQILPRIKALGLCS
YVLGVSTTFYVRLARIQWTRYGDGNAALDVLQELSDSGLYVDNDVRGLLGQMRDNLHGCTWGAQGPFVTKMMEFP
PYDGAFARRLEKLEAEVKQALQQDVAQ*
Coding >Ophcf2|02633
ATGCTGTCATCTGTGTCCCCAGCCCGGGCCCGATGGCGGATACTCGCCTGTCCTGTCATCAGTCGGCTCTCTCGT
CGCGCTCATACGGACATTGAACGCAAGCACGACAATGCAATCCCCTTTGATTGGGGCGACAATAGTCATTTCGGC
GAGCAAGACAACGGGGGCAGCGAGGGCTCGACCATCACGCCGTCTGAGGCCTACATCTTCAAAAGCATATTCGAA
GAGATCGCCACGGGACGGATGCCGCCATCCAAGAAACGTAGCTTTCAGGGCGAAGGCACAAGAGGTGAACATGAT
GGCAGCTTCCGAAAGCACAGAGGCGGCCCGGCACGATCCATCGTCGAACAGGCACGCATTACCGAGTTCCGCGAG
AAGTTCCTCTGTCGTTACCCGCAGTCCCTGCAGGTGGCGGCCAAGATGGCCTTGCGCATGTTCGAGACGGATCCT
TCGACTGCGGATAACACTACAAAGGTGACCGAGGTGGACAAGAAAAAACTAGAGGAGGCCGCGGAATACGAAGCA
GCGAGAACGGAGGAGCGAGTCCGCGTCGAAGCCCTGATGAAGGGCTGTGCCACTGATGTCGCCCTGTGGAAAGTC
ATGGAAGACGAGGTGTTTTCCTTGCCATCGAAGCTGGGCATCGTTCCCGCAAAGAAGCGCATCCGGTCGCCGAGG
CGCTCTGCCAACGCCGGAGAGCCAGCTATCGACGCCAGGAAGCCTACCGAGTCGGAAAGCATCGCGAAAGCACCC
GACAGCCAGAAGCTGAGCATGGATATCCACGGGCCGCTGTACCCCCATTTCCTTGAACAGGGTTTGGATTCATTC
GACACCGCATTCGTCCGGTCGTCACCCTACGCGCTGCAGATCCTTCCTCGCATCAAGGCACTAGGCCTCTGCTCT
TACGTGCTCGGCGTCTCGACGACGTTCTACGTCCGGCTCGCCAGGATTCAGTGGACGCGGTACGGCGACGGCAAT
GCGGCGCTCGATGTGCTGCAGGAGCTGAGCGATTCCGGGCTGTATGTCGACAACGACGTCAGAGGACTGCTCGGA
CAGATGCGCGACAACTTGCACGGATGCACTTGGGGCGCTCAAGGACCGTTTGTCACGAAGATGATGGAATTTCCG
CCCTATGACGGCGCATTCGCCCGGCGGCTGGAGAAATTAGAGGCCGAAGTGAAGCAGGCGCTGCAACAGGACGTG
GCCCAGTGA
Transcript >Ophcf2|02633
ATGCTGTCATCTGTGTCCCCAGCCCGGGCCCGATGGCGGATACTCGCCTGTCCTGTCATCAGTCGGCTCTCTCGT
CGCGCTCATACGGACATTGAACGCAAGCACGACAATGCAATCCCCTTTGATTGGGGCGACAATAGTCATTTCGGC
GAGCAAGACAACGGGGGCAGCGAGGGCTCGACCATCACGCCGTCTGAGGCCTACATCTTCAAAAGCATATTCGAA
GAGATCGCCACGGGACGGATGCCGCCATCCAAGAAACGTAGCTTTCAGGGCGAAGGCACAAGAGGTGAACATGAT
GGCAGCTTCCGAAAGCACAGAGGCGGCCCGGCACGATCCATCGTCGAACAGGCACGCATTACCGAGTTCCGCGAG
AAGTTCCTCTGTCGTTACCCGCAGTCCCTGCAGGTGGCGGCCAAGATGGCCTTGCGCATGTTCGAGACGGATCCT
TCGACTGCGGATAACACTACAAAGGTGACCGAGGTGGACAAGAAAAAACTAGAGGAGGCCGCGGAATACGAAGCA
GCGAGAACGGAGGAGCGAGTCCGCGTCGAAGCCCTGATGAAGGGCTGTGCCACTGATGTCGCCCTGTGGAAAGTC
ATGGAAGACGAGGTGTTTTCCTTGCCATCGAAGCTGGGCATCGTTCCCGCAAAGAAGCGCATCCGGTCGCCGAGG
CGCTCTGCCAACGCCGGAGAGCCAGCTATCGACGCCAGGAAGCCTACCGAGTCGGAAAGCATCGCGAAAGCACCC
GACAGCCAGAAGCTGAGCATGGATATCCACGGGCCGCTGTACCCCCATTTCCTTGAACAGGGTTTGGATTCATTC
GACACCGCATTCGTCCGGTCGTCACCCTACGCGCTGCAGATCCTTCCTCGCATCAAGGCACTAGGCCTCTGCTCT
TACGTGCTCGGCGTCTCGACGACGTTCTACGTCCGGCTCGCCAGGATTCAGTGGACGCGGTACGGCGACGGCAAT
GCGGCGCTCGATGTGCTGCAGGAGCTGAGCGATTCCGGGCTGTATGTCGACAACGACGTCAGAGGACTGCTCGGA
CAGATGCGCGACAACTTGCACGGATGCACTTGGGGCGCTCAAGGACCGTTTGTCACGAAGATGATGGAATTTCCG
CCCTATGACGGCGCATTCGCCCGGCGGCTGGAGAAATTAGAGGCCGAAGTGAAGCAGGCGCTGCAACAGGACGTG
GCCCAGTGA
Gene >Ophcf2|02633
ATGCTGTCATCTGTGTCCCCAGCCCGGGCCCGATGGCGGATACTCGCCTGTCCTGTCATCAGTCGGCTCTCTCGT
CGCGCTCATACGGACATTGAACGCAAGCACGACAATGCAATCCCCTTTGATTGGGGCGACAATAGTCATTTCGGC
GAGCAAGACAACGGGGGCAGCGAGGGCTCGACCATCACGCCGTCTGAGGCCTACATCTTCAAAAGCATATTCGAA
GAGATCGCCACGGGACGGATGCCGCCATCCAAGAAACGTAGCTTTCAGGGCGAAGGCACAAGAGGTGAACATGAT
GGCAGCTTCCGAAAGCACAGAGGCGGCCCGGCACGATCCATCGTCGAACAGGCACGCATTACCGAGTTCCGCGAG
AAGTTCCTCTGTCGTTACCCGCAGTCCCTGCAGGTGGCGGCCAAGATGGCCTTGCGCATGTTCGAGACGGATCCT
TCGACTGCGGATAACACTACAAAGGTGACCGAGGTGGACAAGAAAAAACTAGAGGAGGCCGCGGAATACGAAGCA
GCGAGAACGGAGGAGCGAGTCCGCGTCGAAGCCCTGATGAAGGGCTGTGCCACTGATGTCGCCCTGTGGAAAGTC
ATGGAAGACGAGGTGTTTTCCTTGCCATCGAAGCTGGGCATCGTTCCCGCAAAGAAGCGCATCCGGTCGCCGAGG
CGCTCTGCCAACGCCGGAGAGCCAGCTATCGACGCCAGGAAGCCTACCGAGTCGGAAAGCATCGCGAAAGCACCC
GACAGCCAGAAGCTGAGCATGGATATCCACGGGCCGCTGTACCCCCATTTCCTTGAACAGGGTTTGGATTCATTC
GACACCGCATTCGTCCGGTCGTCACCCTACGCGCTGCAGATCCTTCCTCGCATCAAGGCACTAGGCCTCTGCTCT
TACGTGCTCGGCGTCTCGACGACGTTCTACGTCCGGCTCGCCAGGATTCAGTGGACGCGGTACGGCGACGGCAAT
GCGGCGCTCGATGTGCTGCAGGAGCTGAGCGATTCCGGGCTGTATGTCGACAACGACGTCAGAGGACTGCTCGGA
CAGATGCGCGACAACTTGCACGGATGCACTTGGGGCGCTCAAGGACCGTTTGTCACGAAGATGATGGAATTTCCG
CCCTATGACGGCGCATTCGCCCGGCGGCTGGAGAAATTAGAGGCCGAAGTGAAGCAGGCGCTGCAACAGGACGTG
GCCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail