Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02621
Gene name
Locationscaffold_02:4219795..4220717
Strand+
Gene length (bp)922
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00037 Fer4 4Fe-4S binding domain 4.0E-05 127 146
PF00037 Fer4 4Fe-4S binding domain 6.8E-08 163 184
PF12838 Fer4_7 4Fe-4S dicluster domain 2.0E-12 129 183
PF13237 Fer4_10 4Fe-4S dicluster domain 3.0E-06 127 180
PF13187 Fer4_9 4Fe-4S dicluster domain 2.8E-07 129 184
PF12800 Fer4_4 4Fe-4S binding domain 5.8E-04 128 142

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2409 0.1083 0.0284 0.0843 0.918 0.2263 0.0512 0.0427 0.0725 0.0168

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5657
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3411
Ophiocordyceps australis map64 (Brazil) OphauB2|2874
Ophiocordyceps camponoti-floridani Ophcf2|02621 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2477
Ophiocordyceps kimflemingae Ophio5|1365
Ophiocordyceps subramaniannii Hirsu2|8079

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02621
MAQALQTLPAMLIRRKLLSTLAVPSISTASRTAIVAQSHQRRGYATPKGALPSNFRTDRGIRRRAEDDSTLDHLG
KYFLMTEMARGMYLLLEQFFRPPYTIYYPFEKGPISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAE
ERADGSRRTTRYDIDMTKCIYCGFCQESCPVDAIVESPNAEYATETREELLYNKEKLLSNGDKWEPELAACIRAD
SPYR*
Coding >Ophcf2|02621
ATGGCTCAGGCTTTGCAAACCTTACCGGCGATGCTTATTCGGCGAAAGCTCCTCTCGACCCTTGCGGTTCCCTCC
ATCTCCACCGCCAGTCGAACCGCCATCGTCGCTCAGAGCCACCAACGGCGAGGATACGCGACGCCAAAGGGAGCA
TTGCCGAGCAACTTCCGGACGGACAGAGGGATCAGGAGGCGGGCAGAGGACGATAGCACCTTGGACCACCTGGGC
AAGTACTTTCTGATGACGGAAATGGCCCGGGGGATGTATCTGCTTCTGGAGCAGTTCTTCCGACCTCCCTACACC
ATCTATTACCCCTTTGAAAAGGGCCCCATATCACCCCGATTCCGCGGTGAGCACGCCCTGCGCCGATACCCATCA
GGCGAGGAACGCTGCATCGCCTGCAAGCTATGCGAAGCCATTTGCCCCGCGCAGGCCATCACCATCGAGGCCGAG
GAGCGCGCCGATGGCTCTCGCCGAACCACGCGGTACGACATTGACATGACCAAGTGCATCTACTGCGGTTTCTGC
CAAGAGTCGTGCCCCGTCGACGCCATTGTCGAGAGTCCCAACGCGGAGTACGCGACGGAGACGAGAGAGGAACTG
CTGTACAACAAAGAGAAACTCTTGTCCAACGGAGACAAGTGGGAGCCTGAGCTGGCGGCTTGCATTCGCGCCGAC
TCGCCATACCGTTGA
Transcript >Ophcf2|02621
ATGGCTCAGGCTTTGCAAACCTTACCGGCGATGCTTATTCGGCGAAAGCTCCTCTCGACCCTTGCGGTTCCCTCC
ATCTCCACCGCCAGTCGAACCGCCATCGTCGCTCAGAGCCACCAACGGCGAGGATACGCGACGCCAAAGGGAGCA
TTGCCGAGCAACTTCCGGACGGACAGAGGGATCAGGAGGCGGGCAGAGGACGATAGCACCTTGGACCACCTGGGC
AAGTACTTTCTGATGACGGAAATGGCCCGGGGGATGTATCTGCTTCTGGAGCAGTTCTTCCGACCTCCCTACACC
ATCTATTACCCCTTTGAAAAGGGCCCCATATCACCCCGATTCCGCGGTGAGCACGCCCTGCGCCGATACCCATCA
GGCGAGGAACGCTGCATCGCCTGCAAGCTATGCGAAGCCATTTGCCCCGCGCAGGCCATCACCATCGAGGCCGAG
GAGCGCGCCGATGGCTCTCGCCGAACCACGCGGTACGACATTGACATGACCAAGTGCATCTACTGCGGTTTCTGC
CAAGAGTCGTGCCCCGTCGACGCCATTGTCGAGAGTCCCAACGCGGAGTACGCGACGGAGACGAGAGAGGAACTG
CTGTACAACAAAGAGAAACTCTTGTCCAACGGAGACAAGTGGGAGCCTGAGCTGGCGGCTTGCATTCGCGCCGAC
TCGCCATACCGTTGA
Gene >Ophcf2|02621
ATGGCTCAGGCTTTGCAAACCTTACCGGCGATGCTTATTCGGCGAAAGCTCCTCTCGACCCTTGCGGTTCCCTCC
ATCTCCACCGCCAGTCGAACCGCCATCGTCGCTCAGAGCCACCAACGGCGAGGATACGCGACGCCAAAGGGAGCA
TTGCCGAGCAACTTCCGGACGGACAGAGGGATCAGGAGGCGGGCAGAGGACGATAGCACCTTGGACCACCTGGGC
AAGTACTTTCTGATGACGGAAATGGCCCGGGGGATGTATCTGCTTCTGGAGCAGTTCTTCCGACCTCCGTAGGTT
TTGTCGCTTTCATCAGGTTGCTGATCGATGGTTATTGACTTGCTCGATAGCTACACCATCTATTACCCCTTTGAA
AAGGTACAAACAAACGCTCCATCGATATTCATTCTTCGTCCTCGGAATACCTGACACGAGTGCAGGGCCCCATAT
CACCCCGATTCCGCGGTGAGCACGCCCTGCGCCGATACCCATCAGGCGAGGAACGCTGCATCGCCTGCAAGCTAT
GCGAAGCCGTACGTTTCGCTTTCACGACCGCTTCGAACCCTGAGCTGATGGGGTTCTTGCAATCCAGATTTGCCC
CGCGCAGGCCATCACCATCGAGGCCGAGGAGCGCGCCGATGGCTCTCGCCGAACCACGCGGTACGACATTGACAT
GACCAAGTGCATCTACTGCGGTTTCTGCCAAGAGTCGTGCCCCGTCGACGCCATTGTCGAGAGTCCCAACGCGGA
GTACGCGACGGAGACGAGAGAGGAACTGCTGTACAACAAAGGTGCGTCGCCGCGGGTAACCAGTCGTCAACTTGG
GAGACTGATGAAAAGGGCAGAGAAACTCTTGTCCAACGGAGACAAGTGGGAGCCTGAGCTGGCGGCTTGCATTCG
CGCCGACTCGCCATACCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail