Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02619
Gene name
Locationscaffold_02:4210818..4211887
Strand-
Gene length (bp)1069
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01184 Gpr1_Fun34_YaaH GPR1/FUN34/yaaH family 7.9E-24 83 245

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 80 102 22
3 104 126 22
4 155 177 22
5 184 206 22
6 234 256 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02619
MSSSEQAPQHGQTLAPSSATQPAHISPEMYASLPIVFHKMMKMEMRNNFGCATLIALAGFLLSLSPLACSLMGWR
QTSGLGAATIGTFFFQGGVMMIIGCVLEWVLGNSFFAVVFATYGGFWLSYAATLNPSFAAFSSYAGPNAQSPAEG
LSSPGFLSSLAFWLLFMGLITFIFFVCSMGMSFVFMILFLSLCITFLLLTGALFALANDPVGNARVGGRCIVGAG
SSLFVTSMSGWYVFTSILFSVLGFPVKLPLLEFRCGRRSKEESEV*
Coding >Ophcf2|02619
ATGTCATCGTCCGAACAAGCTCCTCAGCATGGACAAACGCTCGCCCCGTCCTCGGCCACACAGCCAGCCCATATC
AGCCCCGAAATGTACGCCAGCCTGCCCATCGTCTTCCACAAGATGATGAAGATGGAGATGCGCAACAACTTTGGC
TGCGCGACTCTCATTGCCCTCGCCGGCTTTCTCTTGTCTCTCAGTCCTCTGGCCTGTAGCCTGATGGGCTGGCGT
CAGACGAGCGGTCTCGGAGCCGCAACCATAGGCACCTTCTTCTTCCAAGGAGGCGTCATGATGATCATCGGCTGC
GTTCTCGAATGGGTCCTCGGCAACAGTTTCTTTGCCGTCGTCTTCGCCACCTACGGAGGCTTCTGGCTATCATAC
GCCGCGACCTTGAACCCATCCTTTGCCGCCTTTAGTTCCTACGCCGGGCCCAACGCGCAGTCACCGGCTGAGGGT
CTGTCCTCGCCTGGGTTTCTGTCGTCTCTCGCATTCTGGCTGCTGTTCATGGGCCTCATCACCTTCATCTTCTTT
GTGTGCTCCATGGGCATGAGCTTCGTCTTCATGATCCTCTTTCTCAGCTTGTGCATCACTTTCCTCCTCCTTACA
GGTGCGCTCTTCGCCCTGGCCAACGACCCCGTCGGGAATGCCCGTGTGGGCGGCCGGTGTATCGTGGGCGCCGGT
TCCAGCCTCTTCGTGACGTCGATGAGTGGCTGGTACGTCTTCACCTCCATCCTCTTCTCCGTTCTCGGCTTCCCC
GTCAAGCTCCCCCTGCTGGAGTTTCGTTGTGGGAGAAGAAGCAAGGAAGAGAGCGAGGTGTAG
Transcript >Ophcf2|02619
ATGTCATCGTCCGAACAAGCTCCTCAGCATGGACAAACGCTCGCCCCGTCCTCGGCCACACAGCCAGCCCATATC
AGCCCCGAAATGTACGCCAGCCTGCCCATCGTCTTCCACAAGATGATGAAGATGGAGATGCGCAACAACTTTGGC
TGCGCGACTCTCATTGCCCTCGCCGGCTTTCTCTTGTCTCTCAGTCCTCTGGCCTGTAGCCTGATGGGCTGGCGT
CAGACGAGCGGTCTCGGAGCCGCAACCATAGGCACCTTCTTCTTCCAAGGAGGCGTCATGATGATCATCGGCTGC
GTTCTCGAATGGGTCCTCGGCAACAGTTTCTTTGCCGTCGTCTTCGCCACCTACGGAGGCTTCTGGCTATCATAC
GCCGCGACCTTGAACCCATCCTTTGCCGCCTTTAGTTCCTACGCCGGGCCCAACGCGCAGTCACCGGCTGAGGGT
CTGTCCTCGCCTGGGTTTCTGTCGTCTCTCGCATTCTGGCTGCTGTTCATGGGCCTCATCACCTTCATCTTCTTT
GTGTGCTCCATGGGCATGAGCTTCGTCTTCATGATCCTCTTTCTCAGCTTGTGCATCACTTTCCTCCTCCTTACA
GGTGCGCTCTTCGCCCTGGCCAACGACCCCGTCGGGAATGCCCGTGTGGGCGGCCGGTGTATCGTGGGCGCCGGT
TCCAGCCTCTTCGTGACGTCGATGAGTGGCTGGTACGTCTTCACCTCCATCCTCTTCTCCGTTCTCGGCTTCCCC
GTCAAGCTCCCCCTGCTGGAGTTTCGTTGTGGGAGAAGAAGCAAGGAAGAGAGCGAGGTGTAG
Gene >Ophcf2|02619
ATGTCATCGTCCGAACAAGCTCCTCAGCATGGACAAACGCTCGCCCCGTCCTCGGCCACACAGCCAGCCCATATC
AGCCCCGAAATGTACGCCAGCCTGCCCATCGTCTTCCACAAGATGATGAAGATGGAGATGCGCAACAACTTTGGC
TGCGCGACTCTCATGTGAGTCTCCATCACGACGCAGGGCTCAACCCGGCTTACACCCCTCCATCAGTGCCCTCGC
CGGCTTTCTCTTGTCTCTCAGTCCTCTGGCCTGTAGCCTGATGGGCTGGCGTCAGACGAGCGGTCTCGGAGCCGC
AACCATGTAAGTTCACGCGTAGGTACCAGATCTATTGATCCCCTTCCCCATATTCGACTCGACATTCTGACGACA
ACAGAGGCACCTTCTTCTTCCAAGGAGGCGTCATGATGATCATCGGCTGCGTTCTCGAATGGGTCCTCGGCAACA
GTTTCTTTGCCGTCGTCTTCGCCACCTACGGAGGCTTCTGGCTATCATACGCCGCGACCTTGAACCCATCCTTTG
CCGCCTTTAGTTCCTACGCCGGGCCCAACGCGCAGTCACCGGCTGAGGGTCTGTCCTCGCCTGGGTTTCTGTCGT
CTCTCGGTCTGTTCCGACTTTGGTTGAACCCTTGTATGGAGCTCCAGCTGATGAAAGAGTCCGCATAGCATTCTG
GCTGCTGTTCATGGGCCTCATCACCTTCATCTTCTTTGTGTGCTCCATGGGCATGAGCTTCGTCTTCATGATCCT
CTTTCTCAGCTTGTGCATCACTTTCCTCCTCCTTACAGGTGCGCTCTTCGCCCTGGCCAACGACCCCGTCGGGAA
TGCCCGTGTGGGCGGCCGGTGTATCGTGGTGAGCCCCTGTCCCCCATAGACTCTTCCATCTCATCCAAGCAAACA
TCGATGCTAACTACCGACAAAGGGCGCCGGTTCCAGCCTCTTCGTGACGTCGATGAGTGGCTGGTACGTCTTCAC
CTCCATCCTCTTCTCCGTTCTCGGCTTCCCCGTCAAGCTCCCCCTGCTGGAGTTTCGTTGTGGGAGAAGAAGCAA
GGAAGAGAGCGAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail