Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02618
Gene name
Locationscaffold_02:4210200..4210679
Strand+
Gene length (bp)479
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07249 Cerato-platanin Cerato-platanin 2.0E-47 20 137

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.082 0.0467 0.9586 0.0555 0.0689 0.0104 0.085 0.0998 0.0643 0.0059

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999743

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3174
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4157
Ophiocordyceps australis map64 (Brazil) OphauB2|6407
Ophiocordyceps camponoti-floridani Ophcf2|02618 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2473
Ophiocordyceps kimflemingae Ophio5|1363
Ophiocordyceps subramaniannii Hirsu2|5688

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02618
MHLISYLSQALLVAVASATQVSFDAGYDDASRSLNSVSCSDGANGLMTRYHWQTQGQIPGFPYIGGAQGVTWNSP
RCGSCYSIAYRGREIRLLAIDASYNGGFNIGLRAMDFLTDGNGKQFGHIEASTREVPPAECFLR*
Coding >Ophcf2|02618
ATGCACCTCATCAGCTACCTTTCTCAAGCTCTGCTCGTAGCAGTTGCCTCGGCTACACAAGTCTCCTTCGACGCC
GGCTACGACGATGCCTCCCGCTCCCTAAACAGCGTCTCGTGCTCGGACGGGGCCAACGGTCTCATGACGAGATAC
CACTGGCAGACTCAAGGACAGATCCCGGGCTTCCCTTACATCGGCGGCGCCCAGGGCGTTACCTGGAACTCGCCC
CGGTGCGGATCGTGCTACAGCATCGCCTACCGTGGGAGGGAGATTCGCCTGCTGGCCATCGATGCGTCTTATAAT
GGGGGCTTCAACATCGGTCTTCGGGCTATGGACTTCTTGACGGACGGTAACGGGAAGCAGTTTGGGCATATTGAA
GCCTCGACGCGGGAGGTGCCGCCTGCTGAGTGTTTTCTCAGGTAG
Transcript >Ophcf2|02618
ATGCACCTCATCAGCTACCTTTCTCAAGCTCTGCTCGTAGCAGTTGCCTCGGCTACACAAGTCTCCTTCGACGCC
GGCTACGACGATGCCTCCCGCTCCCTAAACAGCGTCTCGTGCTCGGACGGGGCCAACGGTCTCATGACGAGATAC
CACTGGCAGACTCAAGGACAGATCCCGGGCTTCCCTTACATCGGCGGCGCCCAGGGCGTTACCTGGAACTCGCCC
CGGTGCGGATCGTGCTACAGCATCGCCTACCGTGGGAGGGAGATTCGCCTGCTGGCCATCGATGCGTCTTATAAT
GGGGGCTTCAACATCGGTCTTCGGGCTATGGACTTCTTGACGGACGGTAACGGGAAGCAGTTTGGGCATATTGAA
GCCTCGACGCGGGAGGTGCCGCCTGCTGAGTGTTTTCTCAGGTAG
Gene >Ophcf2|02618
ATGCACCTCATCAGCTACCTTTCTCAAGCTCTGCTCGTAGCAGTTGCCTCGGCTACACAAGGTAAGAGAATCTTC
AGTTGTCGTCGCGTCTCACAACTCAAGTGTCGTCGATTCATGTAGTCTCCTTCGACGCCGGCTACGACGATGCCT
CCCGCTCCCTAAACAGCGTCTCGTGCTCGGACGGGGCCAACGGTCTCATGACGAGATACCACTGGCAGACTCAAG
GACAGATCCCGGGCTTCCCTTACATCGGCGGCGCCCAGGGCGTTACCTGGAACTCGCCCCGGTGCGGATCGTGCT
ACAGCATCGCCTACCGTGGGAGGGAGATTCGCCTGCTGGCCATCGATGCGTCTTATAATGGGGGCTTCAACATCG
GTCTTCGGGCTATGGACTTCTTGACGGACGGTAACGGGAAGCAGTTTGGGCATATTGAAGCCTCGACGCGGGAGG
TGCCGCCTGCTGAGTGTTTTCTCAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail