Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02609
Gene name
Locationscaffold_02:4191601..4192077
Strand-
Gene length (bp)476
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20180 UQCC2_CBP6 Complex III assembly factor UQCC2/CBP6 2.9E-19 7 91

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.3234 0.1806 0.1062 0.0984 0.9116 0.0524 0.0984 0.1111 0.1414 0.1312

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5276
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2058
Ophiocordyceps australis map64 (Brazil) OphauB2|3186
Ophiocordyceps camponoti-floridani Ophcf2|02609 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3166
Ophiocordyceps kimflemingae Ophio5|3468
Ophiocordyceps subramaniannii Hirsu2|4639

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02609
MQSVARRVYASVFAQWPTQALRPDYQLQDVLRKSVDERFKNYRPSMEFGELQNARALQLLVEDKFLQKYKLRGPM
LEPKSQPTYFSDLLHEIDEAPKRSWLGRLGKRLSGLIRLR*
Coding >Ophcf2|02609
ATGCAGTCTGTTGCGCGCCGCGTCTACGCCTCCGTCTTCGCCCAGTGGCCTACGCAGGCACTGCGGCCCGACTAC
CAGCTGCAGGACGTGCTGCGCAAGAGCGTCGACGAGCGCTTCAAGAATTACCGACCGTCTATGGAATTCGGGGAG
CTGCAAAATGCTCGCGCGCTGCAGTTGTTGGTGGAGGATAAGTTCCTCCAAAAGTATAAGCTTCGTGGTCCGATG
CTCGAGCCCAAGAGTCAGCCCACCTACTTTTCCGATCTGCTACACGAGATCGATGAGGCGCCGAAACGCTCCTGG
CTCGGCCGACTGGGTAAGAGACTCTCGGGCTTGATCCGGCTGCGGTAG
Transcript >Ophcf2|02609
ATGCAGTCTGTTGCGCGCCGCGTCTACGCCTCCGTCTTCGCCCAGTGGCCTACGCAGGCACTGCGGCCCGACTAC
CAGCTGCAGGACGTGCTGCGCAAGAGCGTCGACGAGCGCTTCAAGAATTACCGACCGTCTATGGAATTCGGGGAG
CTGCAAAATGCTCGCGCGCTGCAGTTGTTGGTGGAGGATAAGTTCCTCCAAAAGTATAAGCTTCGTGGTCCGATG
CTCGAGCCCAAGAGTCAGCCCACCTACTTTTCCGATCTGCTACACGAGATCGATGAGGCGCCGAAACGCTCCTGG
CTCGGCCGACTGGGTAAGAGACTCTCGGGCTTGATCCGGCTGCGGTAG
Gene >Ophcf2|02609
ATGCAGTCTGTTGCGGTAAGCCAATCCCGTATCAAAAACTTCGTCCCAAGATCCCAGCTGAAAGTCCGCCCGCCC
TACAGCGCCGCGTCTACGCCTCCGTCTTCGCCCAGTGGCCTACGCAGGCACTGCGGCCCGACTACCAGCTGCAGG
ACGTGCTGCGCAAGAGCGTCGACGAGCGCTTCAAGAATTACCGACCGTCTATGGAATTCGGGGAGCTGCAAAATG
CTCGCGCGCTGCAGTTGTTGGTGGAGGATAAGTTCCTCCAAAAGGTGCCCACCTCCTCTCCCGCCATGGGGACAG
AGCCAAAGACTGCAGCTGACGGGCGGTTGTAGTATAAGCTTCGTGGTCCGATGCTCGAGCCCAAGAGTCAGCCCA
CCTACTTTTCCGATCTGCTACACGAGATCGATGAGGCGCCGAAACGCTCCTGGCTCGGCCGACTGGGTAAGAGAC
TCTCGGGCTTGATCCGGCTGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail