Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02607
Gene name
Locationscaffold_02:4188079..4188529
Strand+
Gene length (bp)450
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 30.69 9.91 51.47
Alive In ants, during behavior modification 1273.55 0.00 2725.18
Dead In ants, recently dead 238.07 114.50 361.64

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02607
MKLVLLPILLSLPVSLAAALELLYVGAAVDKKSITQQREDCLYDTEAFFSKDCPERPIENSGGDCMSLRRIAKDA
CLTNQSIQASCSKAIERNDKVDCRVRADCWVQVVKILLTQCLSEKSLLASCMTYIQLAMGTCRDGGMADGESWQ*
Coding >Ophcf2|02607
ATGAAGTTAGTCCTGCTTCCCATCCTTCTGTCGCTTCCCGTCAGCCTGGCAGCTGCGCTGGAGCTGCTTTATGTC
GGAGCCGCGGTGGACAAGAAAAGCATCACACAGCAAAGAGAGGACTGCCTTTACGATACAGAGGCCTTCTTTAGC
AAAGACTGCCCCGAGCGACCGATCGAGAACAGCGGAGGGGATTGCATGTCGCTTCGCCGGATAGCCAAGGACGCG
TGCCTAACGAATCAGTCGATACAGGCTTCCTGCAGCAAAGCGATCGAGAGAAACGACAAGGTAGACTGCAGAGTC
CGGGCCGACTGCTGGGTGCAGGTCGTGAAGATCTTGTTGACGCAATGTTTGTCGGAAAAGTCGTTACTGGCGAGC
TGCATGACCTACATCCAGCTCGCCATGGGCACCTGTCGTGACGGTGGAATGGCTGATGGAGAGTCGTGGCAGTGA
Transcript >Ophcf2|02607
ATGAAGTTAGTCCTGCTTCCCATCCTTCTGTCGCTTCCCGTCAGCCTGGCAGCTGCGCTGGAGCTGCTTTATGTC
GGAGCCGCGGTGGACAAGAAAAGCATCACACAGCAAAGAGAGGACTGCCTTTACGATACAGAGGCCTTCTTTAGC
AAAGACTGCCCCGAGCGACCGATCGAGAACAGCGGAGGGGATTGCATGTCGCTTCGCCGGATAGCCAAGGACGCG
TGCCTAACGAATCAGTCGATACAGGCTTCCTGCAGCAAAGCGATCGAGAGAAACGACAAGGTAGACTGCAGAGTC
CGGGCCGACTGCTGGGTGCAGGTCGTGAAGATCTTGTTGACGCAATGTTTGTCGGAAAAGTCGTTACTGGCGAGC
TGCATGACCTACATCCAGCTCGCCATGGGCACCTGTCGTGACGGTGGAATGGCTGATGGAGAGTCGTGGCAGTGA
Gene >Ophcf2|02607
ATGAAGTTAGTCCTGCTTCCCATCCTTCTGTCGCTTCCCGTCAGCCTGGCAGCTGCGCTGGAGCTGCTTTATGTC
GGAGCCGCGGTGGACAAGAAAAGCATCACACAGCAAAGAGAGGACTGCCTTTACGATACAGAGGCCTTCTTTAGC
AAAGACTGCCCCGAGCGACCGATCGAGAACAGCGGAGGGGATTGCATGTCGCTTCGCCGGATAGCCAAGGACGCG
TGCCTAACGAATCAGTCGATACAGGCTTCCTGCAGCAAAGCGATCGAGAGAAACGACAAGGTAGACTGCAGAGTC
CGGGCCGACTGCTGGGTGCAGGTCGTGAAGATCTTGTTGACGCAATGTTTGTCGGAAAAGTCGTTACTGGCGAGC
TGCATGACCTACATCCAGCTCGCCATGGGCACCTGTCGTGACGGTGGAATGGCTGATGGAGAGTCGTGGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail