Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02603
Gene name
Locationscaffold_02:4179125..4183029
Strand-
Gene length (bp)3904
Transcript length (bp)3708
Coding sequence length (bp)3708
Protein length (aa) 1236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00368 HMG-CoA_red Hydroxymethylglutaryl-coenzyme A reductase 3.7E-139 813 1196
PF13323 HPIH N-terminal domain with HPIH motif 9.7E-49 79 226
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 2.7E-09 317 484
PF02460 Patched Patched family 1.3E-05 282 508

GO

GO Term Description Terminal node
GO:0004420 hydroxymethylglutaryl-CoA reductase (NADPH) activity Yes
GO:0015936 coenzyme A metabolic process Yes
GO:0016021 integral component of membrane Yes
GO:0044281 small molecule metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0006163 purine nucleotide metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0016491 oxidoreductase activity No
GO:0031224 intrinsic component of membrane No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0009117 nucleotide metabolic process No
GO:0003674 molecular_function No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 289 311 22
2 318 340 22
3 344 366 22
4 428 447 19
5 452 474 22
6 540 562 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02603
MYLLDCRRCPLFLSLKANVESLPSLPSTDLALSPLQSPIANAVRRGTSTMISTSILPTRFRGESRRDEKAIPSPL
AKSISPILQNMAKVACHHPIHTVVIVALLASTSYVSLLQESLFDATPAIGKADWSSLVDGSRDLLVGPDTAWKWR
SVEHASASAAADTDHLALLTLVFPDSLTTDSSNTAPPSHAVPTPGNLSITPLPTTENSFTAYSQDTILAYSLPYR
QASEFVSAIQEIPHEDAEETTTRHGREKKTWIMKAAKVDTRTTLAQWLHNAWTEFIDLLKNAETLDIFIMILGYI
SMHLTFVSLFLSMRRMGSNFWLATSTLLASVFAFILALTVTTKLGVPISFILLSEGLPFLVVTIGFEKNIVLTRA
VLSRAVEYRTRRAQAQAQASKTDDADKAPTQTVIQYAIQAAIKDKGFDILRDYAIEIAILVLGAASGVQGGLQQF
CFLAAWILFFDCILLFTFSTAILSIKLEIKRIKRHVDMRMTLEADGVSRRVAENVAAADDEWLLSGNRSEDESSL
FGHNAKSSSIPRFKVLMISGFFLINIINICTIPFRSAASLSSLRSWAGGLGGVASSPPVDPFKVACNGLDAILAT
FKVSGKSALVTVLTPIKYELQYPSVHYGLSSPPCDGSTAACDGAGRLDGYGVGGRMVGGLLKSLEDPILSKWIVV
ALALSVGLNGYLFNAARSGIKDPNVPDRAIDRKELARAQLFNDTELSSLPLGGYPPPPTPVQNEPPTPSSSTDDE
ADAASRAKLIPVPENRPVAVLDKMVAEKRAHEMTDEEVVSSSLRGKIPGYALEKSLKDFTRAVKIRRMIISRTKV
TAALTNGLDRSKLPFENYNWERVFGACCENVIGYLPLPVGVAGPLVVDGQSYFIPMATTEGVLVASTSRGCKAIN
SGGGAITVLTADGMTRGPCVSFETLERAGAAKIWLDSAKGQTLMKEAFDSTSRFARLQTMKTALAGTNLYIRFKT
TTGDAMGMNMISKGVEQALNAMASEGGFDDMSVVSLSGNFCIDKKPAAINWIDGRGKSIVAEAIIPAEVVKTVLK
CDVDALVELNVSKNLIGSAMAGSIGGFNAHAANIVAAVFLATGQDPAQVVESANCITTMKNLHGSLQISVSMPSL
EVGTLGGGTILEPQSAMLEMLGVRGAHPTTPGDNARRLARVIGAAVLAGELSLCSALAAGHLVRAHMQHNRSAAP
SRAATPSISPISPLRPVLERSTQSLSAAALQRSRR*
Coding >Ophcf2|02603
ATGTACCTACTAGACTGCCGGCGTTGTCCCCTTTTTCTTTCCCTCAAGGCAAACGTCGAATCTCTTCCCTCTCTA
CCGAGTACCGACCTAGCTCTGTCGCCGCTCCAATCGCCAATCGCCAATGCCGTAAGGCGAGGCACGTCGACCATG
ATCTCTACTTCCATCCTCCCGACGCGCTTCCGTGGCGAATCGCGGCGCGATGAAAAGGCCATTCCCTCGCCCTTG
GCCAAAAGCATATCGCCTATCCTTCAGAACATGGCCAAGGTGGCCTGCCATCACCCCATTCATACCGTCGTCATC
GTCGCCCTCTTGGCAAGCACCTCGTACGTCAGCCTCCTTCAGGAGAGCCTGTTCGACGCAACCCCTGCCATCGGC
AAGGCAGACTGGTCCTCTCTGGTCGACGGTAGTAGAGATCTGCTCGTCGGCCCGGACACGGCCTGGAAATGGCGC
AGCGTGGAGCACGCCTCTGCCTCGGCCGCCGCAGACACCGACCACCTCGCTCTCCTGACTCTCGTCTTTCCGGAC
TCGCTCACCACCGATTCCTCCAACACCGCTCCCCCGTCGCACGCCGTACCAACCCCGGGCAACCTCTCCATCACA
CCCCTTCCCACTACAGAAAACTCCTTCACCGCCTACTCGCAGGATACCATTCTCGCTTACTCGTTGCCTTACCGC
CAGGCCTCCGAGTTCGTCTCCGCCATTCAGGAGATCCCACACGAAGATGCCGAAGAGACGACAACGCGCCACGGC
CGCGAGAAGAAGACTTGGATCATGAAGGCTGCCAAGGTTGACACCCGCACCACCCTTGCTCAGTGGCTGCACAAC
GCATGGACCGAGTTCATAGACCTGCTCAAGAACGCCGAGACGCTCGACATCTTCATCATGATTCTCGGCTACATA
TCCATGCACCTGACCTTTGTCTCACTCTTCCTCTCAATGCGCCGAATGGGCTCCAACTTTTGGCTCGCCACAAGC
ACCCTCTTGGCCTCCGTCTTTGCCTTTATCCTCGCCCTGACCGTCACCACCAAGCTCGGCGTCCCCATCAGCTTC
ATTCTGCTGTCCGAGGGTTTGCCCTTCCTGGTCGTCACCATAGGATTCGAGAAGAACATCGTTCTGACTCGCGCC
GTCCTCTCCCGCGCCGTCGAATACCGCACTCGCCGCGCCCAGGCTCAGGCTCAGGCCTCCAAGACGGACGACGCT
GACAAGGCGCCGACGCAGACCGTCATTCAGTACGCCATCCAGGCCGCCATCAAGGACAAAGGCTTCGATATCCTG
CGCGACTATGCCATTGAGATCGCTATCCTCGTCTTGGGTGCAGCCTCCGGCGTCCAGGGTGGCCTACAGCAGTTT
TGCTTCCTCGCCGCCTGGATCCTCTTCTTCGACTGCATCCTCCTCTTCACCTTTAGCACCGCCATTCTCAGCATC
AAGCTCGAAATCAAGCGCATCAAACGCCATGTTGATATGCGCATGACGCTCGAGGCCGACGGGGTTAGCCGCCGC
GTGGCTGAAAACGTGGCCGCGGCCGACGATGAGTGGCTGCTGTCCGGTAACCGGTCGGAGGATGAGTCGTCCCTC
TTTGGGCACAACGCCAAGAGCAGCAGCATACCCAGGTTCAAGGTGCTCATGATATCCGGGTTCTTCCTCATCAAC
ATCATCAACATCTGCACAATCCCCTTTCGCAGCGCCGCCTCGTTATCCTCTCTCCGCTCTTGGGCTGGTGGGCTC
GGCGGCGTCGCTTCCAGCCCGCCCGTCGACCCCTTCAAGGTAGCCTGCAACGGGCTCGACGCCATCCTGGCGACC
TTCAAGGTCAGCGGCAAGTCGGCCCTCGTCACCGTCCTGACGCCCATCAAGTACGAGCTCCAGTACCCTTCTGTG
CACTACGGCCTGTCATCTCCGCCTTGCGACGGTAGCACCGCCGCGTGCGACGGAGCCGGTCGGCTCGACGGCTAC
GGCGTCGGCGGCCGCATGGTCGGCGGCCTCCTCAAGAGCCTCGAGGATCCCATTCTGTCCAAGTGGATTGTCGTT
GCCCTGGCCCTGAGCGTCGGTCTCAACGGATATCTCTTCAACGCGGCCCGCAGCGGCATCAAGGACCCCAACGTC
CCCGACAGAGCCATCGACCGCAAGGAGCTCGCGCGCGCCCAGCTGTTCAACGACACAGAGCTGTCGTCCCTACCG
CTCGGAGGCTACCCGCCGCCTCCCACGCCGGTGCAGAATGAACCGCCGACCCCGTCTTCGTCCACGGATGACGAA
GCAGACGCCGCGTCCAGGGCCAAACTCATCCCGGTCCCCGAGAACCGGCCCGTTGCGGTCCTGGACAAGATGGTG
GCCGAGAAGCGGGCGCACGAGATGACGGACGAGGAGGTCGTATCGTCGTCGCTACGGGGCAAGATACCCGGCTAT
GCTCTCGAAAAGTCGTTGAAGGACTTTACTCGGGCCGTCAAGATCAGGCGCATGATCATCTCCCGCACCAAGGTG
ACGGCCGCGCTCACCAACGGCCTGGATCGGAGCAAGCTTCCATTCGAAAACTACAACTGGGAGCGCGTCTTCGGA
GCCTGCTGCGAAAACGTCATCGGCTACCTCCCGCTGCCCGTCGGCGTCGCGGGACCCCTCGTCGTCGACGGCCAG
AGCTACTTCATTCCCATGGCGACGACGGAGGGCGTTCTGGTGGCGAGCACCAGCAGAGGATGCAAGGCCATCAAC
TCGGGCGGCGGCGCCATCACCGTCCTGACGGCAGACGGCATGACCCGCGGCCCCTGCGTGAGCTTCGAGACGCTA
GAGCGGGCCGGCGCGGCCAAGATCTGGCTCGATTCGGCCAAGGGGCAGACGTTGATGAAGGAGGCCTTTGACTCG
ACCAGTCGCTTCGCCCGGCTGCAGACGATGAAGACGGCCCTCGCCGGCACTAACCTATACATTCGGTTTAAGACG
ACTACGGGCGACGCGATGGGTATGAACATGATCTCCAAGGGCGTCGAGCAAGCCTTGAATGCCATGGCCTCCGAA
GGCGGCTTCGACGATATGTCGGTCGTGTCCCTTTCGGGTAACTTTTGCATCGATAAGAAGCCGGCGGCTATCAAC
TGGATCGACGGACGCGGCAAGAGCATCGTGGCCGAGGCTATCATCCCGGCCGAGGTGGTCAAGACGGTGCTCAAG
TGTGACGTCGATGCGCTCGTGGAACTCAACGTATCAAAGAACCTAATCGGCTCGGCCATGGCCGGGTCTATCGGC
GGATTCAACGCGCACGCTGCCAACATAGTGGCCGCCGTCTTCCTCGCTACGGGCCAAGACCCGGCACAGGTAGTG
GAGAGTGCCAACTGCATCACGACGATGAAGAACCTCCACGGATCACTTCAGATCTCGGTGTCGATGCCATCGCTC
GAGGTGGGCACGCTGGGCGGCGGCACCATCTTGGAGCCCCAGAGCGCCATGCTCGAGATGCTTGGCGTGCGAGGC
GCGCACCCGACGACTCCGGGCGACAACGCACGACGTCTGGCTCGAGTGATAGGAGCGGCCGTCCTGGCGGGCGAG
TTGTCGCTCTGCAGCGCGCTGGCGGCAGGACACCTGGTGCGGGCACATATGCAGCACAACCGGAGCGCGGCGCCG
TCTAGAGCTGCGACGCCCAGCATATCACCGATTTCTCCCCTGAGACCGGTGCTGGAGAGATCGACTCAGTCGCTG
AGTGCCGCAGCCCTGCAGCGTTCGAGGCGGTGA
Transcript >Ophcf2|02603
ATGTACCTACTAGACTGCCGGCGTTGTCCCCTTTTTCTTTCCCTCAAGGCAAACGTCGAATCTCTTCCCTCTCTA
CCGAGTACCGACCTAGCTCTGTCGCCGCTCCAATCGCCAATCGCCAATGCCGTAAGGCGAGGCACGTCGACCATG
ATCTCTACTTCCATCCTCCCGACGCGCTTCCGTGGCGAATCGCGGCGCGATGAAAAGGCCATTCCCTCGCCCTTG
GCCAAAAGCATATCGCCTATCCTTCAGAACATGGCCAAGGTGGCCTGCCATCACCCCATTCATACCGTCGTCATC
GTCGCCCTCTTGGCAAGCACCTCGTACGTCAGCCTCCTTCAGGAGAGCCTGTTCGACGCAACCCCTGCCATCGGC
AAGGCAGACTGGTCCTCTCTGGTCGACGGTAGTAGAGATCTGCTCGTCGGCCCGGACACGGCCTGGAAATGGCGC
AGCGTGGAGCACGCCTCTGCCTCGGCCGCCGCAGACACCGACCACCTCGCTCTCCTGACTCTCGTCTTTCCGGAC
TCGCTCACCACCGATTCCTCCAACACCGCTCCCCCGTCGCACGCCGTACCAACCCCGGGCAACCTCTCCATCACA
CCCCTTCCCACTACAGAAAACTCCTTCACCGCCTACTCGCAGGATACCATTCTCGCTTACTCGTTGCCTTACCGC
CAGGCCTCCGAGTTCGTCTCCGCCATTCAGGAGATCCCACACGAAGATGCCGAAGAGACGACAACGCGCCACGGC
CGCGAGAAGAAGACTTGGATCATGAAGGCTGCCAAGGTTGACACCCGCACCACCCTTGCTCAGTGGCTGCACAAC
GCATGGACCGAGTTCATAGACCTGCTCAAGAACGCCGAGACGCTCGACATCTTCATCATGATTCTCGGCTACATA
TCCATGCACCTGACCTTTGTCTCACTCTTCCTCTCAATGCGCCGAATGGGCTCCAACTTTTGGCTCGCCACAAGC
ACCCTCTTGGCCTCCGTCTTTGCCTTTATCCTCGCCCTGACCGTCACCACCAAGCTCGGCGTCCCCATCAGCTTC
ATTCTGCTGTCCGAGGGTTTGCCCTTCCTGGTCGTCACCATAGGATTCGAGAAGAACATCGTTCTGACTCGCGCC
GTCCTCTCCCGCGCCGTCGAATACCGCACTCGCCGCGCCCAGGCTCAGGCTCAGGCCTCCAAGACGGACGACGCT
GACAAGGCGCCGACGCAGACCGTCATTCAGTACGCCATCCAGGCCGCCATCAAGGACAAAGGCTTCGATATCCTG
CGCGACTATGCCATTGAGATCGCTATCCTCGTCTTGGGTGCAGCCTCCGGCGTCCAGGGTGGCCTACAGCAGTTT
TGCTTCCTCGCCGCCTGGATCCTCTTCTTCGACTGCATCCTCCTCTTCACCTTTAGCACCGCCATTCTCAGCATC
AAGCTCGAAATCAAGCGCATCAAACGCCATGTTGATATGCGCATGACGCTCGAGGCCGACGGGGTTAGCCGCCGC
GTGGCTGAAAACGTGGCCGCGGCCGACGATGAGTGGCTGCTGTCCGGTAACCGGTCGGAGGATGAGTCGTCCCTC
TTTGGGCACAACGCCAAGAGCAGCAGCATACCCAGGTTCAAGGTGCTCATGATATCCGGGTTCTTCCTCATCAAC
ATCATCAACATCTGCACAATCCCCTTTCGCAGCGCCGCCTCGTTATCCTCTCTCCGCTCTTGGGCTGGTGGGCTC
GGCGGCGTCGCTTCCAGCCCGCCCGTCGACCCCTTCAAGGTAGCCTGCAACGGGCTCGACGCCATCCTGGCGACC
TTCAAGGTCAGCGGCAAGTCGGCCCTCGTCACCGTCCTGACGCCCATCAAGTACGAGCTCCAGTACCCTTCTGTG
CACTACGGCCTGTCATCTCCGCCTTGCGACGGTAGCACCGCCGCGTGCGACGGAGCCGGTCGGCTCGACGGCTAC
GGCGTCGGCGGCCGCATGGTCGGCGGCCTCCTCAAGAGCCTCGAGGATCCCATTCTGTCCAAGTGGATTGTCGTT
GCCCTGGCCCTGAGCGTCGGTCTCAACGGATATCTCTTCAACGCGGCCCGCAGCGGCATCAAGGACCCCAACGTC
CCCGACAGAGCCATCGACCGCAAGGAGCTCGCGCGCGCCCAGCTGTTCAACGACACAGAGCTGTCGTCCCTACCG
CTCGGAGGCTACCCGCCGCCTCCCACGCCGGTGCAGAATGAACCGCCGACCCCGTCTTCGTCCACGGATGACGAA
GCAGACGCCGCGTCCAGGGCCAAACTCATCCCGGTCCCCGAGAACCGGCCCGTTGCGGTCCTGGACAAGATGGTG
GCCGAGAAGCGGGCGCACGAGATGACGGACGAGGAGGTCGTATCGTCGTCGCTACGGGGCAAGATACCCGGCTAT
GCTCTCGAAAAGTCGTTGAAGGACTTTACTCGGGCCGTCAAGATCAGGCGCATGATCATCTCCCGCACCAAGGTG
ACGGCCGCGCTCACCAACGGCCTGGATCGGAGCAAGCTTCCATTCGAAAACTACAACTGGGAGCGCGTCTTCGGA
GCCTGCTGCGAAAACGTCATCGGCTACCTCCCGCTGCCCGTCGGCGTCGCGGGACCCCTCGTCGTCGACGGCCAG
AGCTACTTCATTCCCATGGCGACGACGGAGGGCGTTCTGGTGGCGAGCACCAGCAGAGGATGCAAGGCCATCAAC
TCGGGCGGCGGCGCCATCACCGTCCTGACGGCAGACGGCATGACCCGCGGCCCCTGCGTGAGCTTCGAGACGCTA
GAGCGGGCCGGCGCGGCCAAGATCTGGCTCGATTCGGCCAAGGGGCAGACGTTGATGAAGGAGGCCTTTGACTCG
ACCAGTCGCTTCGCCCGGCTGCAGACGATGAAGACGGCCCTCGCCGGCACTAACCTATACATTCGGTTTAAGACG
ACTACGGGCGACGCGATGGGTATGAACATGATCTCCAAGGGCGTCGAGCAAGCCTTGAATGCCATGGCCTCCGAA
GGCGGCTTCGACGATATGTCGGTCGTGTCCCTTTCGGGTAACTTTTGCATCGATAAGAAGCCGGCGGCTATCAAC
TGGATCGACGGACGCGGCAAGAGCATCGTGGCCGAGGCTATCATCCCGGCCGAGGTGGTCAAGACGGTGCTCAAG
TGTGACGTCGATGCGCTCGTGGAACTCAACGTATCAAAGAACCTAATCGGCTCGGCCATGGCCGGGTCTATCGGC
GGATTCAACGCGCACGCTGCCAACATAGTGGCCGCCGTCTTCCTCGCTACGGGCCAAGACCCGGCACAGGTAGTG
GAGAGTGCCAACTGCATCACGACGATGAAGAACCTCCACGGATCACTTCAGATCTCGGTGTCGATGCCATCGCTC
GAGGTGGGCACGCTGGGCGGCGGCACCATCTTGGAGCCCCAGAGCGCCATGCTCGAGATGCTTGGCGTGCGAGGC
GCGCACCCGACGACTCCGGGCGACAACGCACGACGTCTGGCTCGAGTGATAGGAGCGGCCGTCCTGGCGGGCGAG
TTGTCGCTCTGCAGCGCGCTGGCGGCAGGACACCTGGTGCGGGCACATATGCAGCACAACCGGAGCGCGGCGCCG
TCTAGAGCTGCGACGCCCAGCATATCACCGATTTCTCCCCTGAGACCGGTGCTGGAGAGATCGACTCAGTCGCTG
AGTGCCGCAGCCCTGCAGCGTTCGAGGCGGTGA
Gene >Ophcf2|02603
ATGTACCTACTAGGTATGTGAGAAGTGCCTCTCGATACCTACGCGACCACGGGTTTACGCCTGCCTGCTCCCTGC
CGCCTGCTGCCTGCTGATGATCGACTCTCTCCTGCAGACTGCCGGCGTTGTCCCCTTTTTCTTTCCCTCAAGGCA
AACGTCGAATCTCTTCCCTCTCTACCGAGTACCGACCTAGGTGAAAGCATAGGGCATCGCCGCTGTTCTTCGCGC
TTCCTCGTCGAGCTCTGTCGCCGCTCCAATCGCCAATCGCCAATGCCGTAAGGCGAGGCACGTCGACCATGATCT
CTACTTCCATCCTCCCGACGCGCTTCCGTGGCGAATCGCGGCGCGATGAAAAGGCCATTCCCTCGCCCTTGGCCA
AAAGCATATCGCCTATCCTTCAGAACATGGCCAAGGTGGCCTGCCATCACCCCATTCATACCGTCGTCATCGTCG
CCCTCTTGGCAAGCACCTCGTACGTCAGCCTCCTTCAGGAGAGCCTGTTCGACGCAACCCCTGCCATCGGCAAGG
CAGACTGGTCCTCTCTGGTCGACGGTAGTAGAGATCTGCTCGTCGGCCCGGACACGGCCTGGAAATGGCGCAGCG
TGGAGCACGCCTCTGCCTCGGCCGCCGCAGACACCGACCACCTCGCTCTCCTGACTCTCGTCTTTCCGGACTCGC
TCACCACCGATTCCTCCAACACCGCTCCCCCGTCGCACGCCGTACCAACCCCGGGCAACCTCTCCATCACACCCC
TTCCCACTACAGAAAACTCCTTCACCGCCTACTCGCAGGATACCATTCTCGCTTACTCGTTGCCTTACCGCCAGG
CCTCCGAGTTCGTCTCCGCCATTCAGGAGATCCCACACGAAGATGCCGAAGAGACGACAACGCGCCACGGCCGCG
AGAAGAAGACTTGGATCATGAAGGCTGCCAAGGTTGACACCCGCACCACCCTTGCTCAGTGGCTGCACAACGCAT
GGACCGAGTTCATAGACCTGCTCAAGAACGCCGAGACGCTCGACATCTTCATCATGATTCTCGGCTACATATCCA
TGCACCTGACCTTTGTCTCACTCTTCCTCTCAATGCGCCGAATGGGCTCCAACTTTTGGCTCGCCACAAGCACCC
TCTTGGCCTCCGTCTTTGCCTTTATCCTCGCCCTGACCGTCACCACCAAGCTCGGCGTCCCCATCAGCTTCATTC
TGCTGTCCGAGGGTTTGCCCTTCCTGGTCGTCACCATAGGATTCGAGAAGAACATCGTTCTGACTCGCGCCGTCC
TCTCCCGCGCCGTCGAATACCGCACTCGCCGCGCCCAGGCTCAGGCTCAGGCCTCCAAGACGGACGACGCTGACA
AGGCGCCGACGCAGACCGTCATTCAGTACGCCATCCAGGCCGCCATCAAGGACAAAGGCTTCGATATCCTGCGCG
ACTATGCCATTGAGATCGCTATCCTCGTCTTGGGTGCAGCCTCCGGCGTCCAGGGTGGCCTACAGCAGTTTTGCT
TCCTCGCCGCCTGGATCCTCTTCTTCGACTGCATCCTCCTCTTCACCTTTAGCACCGCCATTCTCAGCATCAAGC
TCGAAATCAAGCGCATCAAACGCCATGTTGATATGCGCATGACGCTCGAGGCCGACGGGGTTAGCCGCCGCGTGG
CTGAAAACGTGGCCGCGGCCGACGATGAGTGGCTGCTGTCCGGTAACCGGTCGGAGGATGAGTCGTCCCTCTTTG
GGCACAACGCCAAGAGCAGCAGCATACCCAGGTTCAAGGTGCTCATGATATCCGGGTTCTTCCTCATCAACATCA
TCAACATCTGCACAATCCCCTTTCGCAGCGCCGCCTCGTTATCCTCTCTCCGCTCTTGGGCTGGTGGGCTCGGCG
GCGTCGCTTCCAGCCCGCCCGTCGACCCCTTCAAGGTAGCCTGCAACGGGCTCGACGCCATCCTGGCGACCTTCA
AGGTCAGCGGCAAGTCGGCCCTCGTCACCGTCCTGACGCCCATCAAGTACGAGCTCCAGTACCCTTCTGTGCACT
ACGGCCTGTCATCTCCGCCTTGCGACGGTAGCACCGCCGCGTGCGACGGAGCCGGTCGGCTCGACGGCTACGGCG
TCGGCGGCCGCATGGTCGGCGGCCTCCTCAAGAGCCTCGAGGATCCCATTCTGTCCAAGTGGATTGTCGTTGCCC
TGGCCCTGAGCGTCGGTCTCAACGGATATCTCTTCAACGCGGCCCGCAGCGGCATCAAGGACCCCAACGTCCCCG
ACAGAGCCATCGACCGCAAGGAGCTCGCGCGCGCCCAGCTGTTCAACGACACAGAGCTGTCGTCCCTACCGCTCG
GAGGCTACCCGCCGCCTCCCACGCCGGTGCAGAATGAACCGCCGACCCCGTCTTCGTCCACGGATGACGAAGCAG
ACGCCGCGTCCAGGGCCAAACTCATCCCGGTCCCCGAGAACCGGCCCGTTGCGGTCCTGGACAAGATGGTGGCCG
AGAAGCGGGCGCACGAGATGACGGACGAGGAGGTCGTATCGTCGTCGCTACGGGGCAAGATACCCGGCTATGCTC
TCGAAAAGTCGTTGAAGGACTTTACTCGGGCCGTCAAGATCAGGCGCATGATCATCTCCCGCACCAAGGTGACGG
CCGCGCTCACCAACGGCCTGGATCGGAGCAAGCTTCCATTCGAAAACTACAACTGGGAGCGCGTCTTCGGAGCCT
GCTGCGAAAACGTCATCGGCTACCTCCCGCTGCCCGTCGGCGTCGCGGGACCCCTCGTCGTCGACGGCCAGAGCT
ACTTCATTCCCATGGCGACGACGGAGGGCGTTCTGGTGGCGAGCACCAGCAGAGGATGCAAGGCCATCAACTCGG
GCGGCGGCGCCATCACCGTCCTGACGGCAGACGGCATGACCCGCGGCCCCTGCGTGAGCTTCGAGACGCTAGAGC
GGGCCGGCGCGGCCAAGATCTGGCTCGATTCGGCCAAGGGGCAGACGTTGATGAAGGAGGCCTTTGACTCGACCA
GTCGCTTCGCCCGGCTGCAGACGATGAAGACGGCCCTCGCCGGCACTAACCTATACATTCGGTTTAAGACGACTA
CGGGCGACGCGATGGGTATGAACATGATCTCCAAGGGCGTCGAGCAAGCCTTGAATGCCATGGCCTCCGAAGGCG
GCTTCGACGATATGTCGGTCGTGTCCCTTTCGGGTAACTTTTGCATCGATAAGAAGCCGGCGGCTATCAACTGGA
TCGACGGACGCGGCAAGAGCATCGTGGCCGAGGCTATCATCCCGGCCGAGGTGGTCAAGACGGTGCTCAAGTGTG
ACGTCGATGCGCTCGTGGAACTCAACGTATCAAAGAACCTAATCGGCTCGGCCATGGCCGGGTCTATCGGCGGAT
TCAACGCGCACGCTGCCAACATAGTGGCCGCCGTCTTCCTCGCTACGGGCCAAGACCCGGCACAGGTAGTGGAGA
GTGCCAACTGCATCACGACGATGAAGAAGTGAGCCAGCCAGAACCCGCCTCTCTATGAACACAGCTGACAGTCGA
CAGCCTCCACGGATCACTTCAGATCTCGGTGTCGATGCCATCGCTCGAGGTGGGCACGCTGGGCGGCGGCACCAT
CTTGGAGCCCCAGAGCGCCATGCTCGAGATGCTTGGCGTGCGAGGCGCGCACCCGACGACTCCGGGCGACAACGC
ACGACGTCTGGCTCGAGTGATAGGAGCGGCCGTCCTGGCGGGCGAGTTGTCGCTCTGCAGCGCGCTGGCGGCAGG
ACACCTGGTGCGGGCACATATGCAGCACAACCGGAGCGCGGCGCCGTCTAGAGCTGCGACGCCCAGCATATCACC
GATTTCTCCCCTGAGACCGGTGCTGGAGAGATCGACTCAGTCGCTGAGTGCCGCAGCCCTGCAGCGTTCGAGGCG
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail