Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02598
Gene name
Locationscaffold_02:4168523..4171106
Strand-
Gene length (bp)2583
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 4.9E-40 162 440
PF01483 P_proprotein Proprotein convertase P-domain 6.0E-26 500 586

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 676 698 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 8.50 3.89 13.11
Alive In ants, during behavior modification 123.68 56.14 191.22
Dead In ants, recently dead 56.28 31.49 81.07

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02598
MAFRDYSLFDFYVVHLAESASPEEIASELGMRLDGRHSLPHHYVLRTSKSSEDQLQQRLTKRKLMKRDAQQDHIV
RDVLLARKQEPRMRLHKRIIPPGPAAAMRSRALKLPLDTATVKKQQDVMGTLNIHDPMFEEQWHLLNTRQPGHDI
NVTGLWLEGITGKDATVAIVDDGLDMSSDDLKNNYFAAGSWDFNDKGAEPRPRLSDDKHGTRCAGEVAAARNDVC
GVGAAYDARVAGIRILSKPISDADEADAMVYKNQENQIYSCSWGPRDDGRSMEAPGILIQRAILHGIQEGRGGLG
SIFVFASGNGAASDDNCNFDGYTNSIYSITIGAIDRAGHHPYYSELCSAQLVVTYSSGDGDSIHTTDVGTNQCTS
SHGGTSAAAPLAAGIFALVMQVRPDLGWRDVQYLAMETAQPIADQPESWQTTSIGKRYSHYFGYGKIDSYALVES
AKTWTKVKPQAWFFSPWIHVKTAIPEGGDGLTAHFEVTSDMMKKANLERVEHVTITMNVNHTRRGDLSVDLVSPQ
NVVSHIATARAHDSHNGGYVDWTFMTVVHWGESGIGNWSLVVHDTKENKHRGTFVDWRMKLWGEAMDAGAAYNLP
MPETTDDDDHDKTVSSVAGPVATSGGRPNQKPPPQPTMTALPTDHPERPTKPGGAQLSSSSPSVVSSPAAKAGPF
WIYGAFSLIVVFCVGLGAYLWIARRRRLRNKARDSYEFELIDEEETEAINGLEKDAAGGQRGGRRTRGGELYDAF
AGNSEDDDDADDDDDDDGTGQVREYRDGSQDRLTPSDETEQYVVGEESDVSDTEAVSPTDSKLLGGRAP*
Coding >Ophcf2|02598
ATGGCCTTTCGAGACTACAGTCTCTTCGACTTTTATGTCGTTCACCTCGCCGAGTCCGCTTCCCCGGAAGAAATC
GCCTCGGAGCTGGGCATGCGACTCGATGGCCGCCATTCACTACCCCATCACTACGTCTTACGGACGTCAAAGTCT
TCCGAGGACCAGCTACAGCAGCGCCTGACGAAGCGGAAGCTTATGAAGCGAGATGCTCAACAAGACCACATCGTT
CGCGATGTCCTGCTGGCTCGCAAACAAGAGCCGAGGATGCGACTGCACAAGCGCATCATCCCTCCCGGTCCGGCT
GCTGCCATGCGATCCCGCGCCTTGAAGTTGCCGCTCGACACGGCCACAGTCAAGAAGCAACAGGATGTCATGGGC
ACTCTCAACATCCACGACCCCATGTTTGAGGAGCAATGGCATCTACTCAACACGCGCCAGCCCGGCCACGACATC
AATGTCACGGGGCTATGGCTCGAGGGTATCACGGGCAAGGACGCGACAGTGGCCATCGTCGATGACGGTCTCGAC
ATGAGCAGCGACGACCTGAAAAACAATTACTTCGCCGCCGGCTCCTGGGATTTCAACGACAAGGGCGCCGAGCCC
CGTCCGCGCCTATCCGACGACAAGCACGGCACCCGCTGCGCCGGCGAGGTGGCAGCCGCCCGCAATGACGTTTGC
GGCGTCGGAGCTGCCTACGATGCTCGCGTCGCCGGCATTCGCATACTCAGCAAGCCCATCAGCGACGCCGACGAG
GCAGACGCCATGGTCTACAAGAACCAGGAGAACCAGATCTACTCGTGCTCGTGGGGACCCCGTGACGACGGCCGT
TCCATGGAGGCGCCCGGAATCCTCATTCAACGCGCCATCCTCCACGGAATCCAGGAGGGCCGCGGCGGCCTCGGT
TCCATCTTCGTCTTCGCCAGCGGCAACGGCGCCGCCAGCGACGATAACTGCAATTTTGACGGATACACAAACTCC
ATCTACAGCATCACTATAGGCGCCATCGACCGCGCCGGCCACCATCCCTACTACTCGGAGCTGTGCTCGGCCCAG
CTCGTCGTCACCTACAGCAGCGGAGACGGAGATTCCATCCACACCACCGATGTCGGCACGAACCAGTGCACCTCT
AGCCACGGCGGAACGTCGGCTGCCGCGCCCCTTGCCGCCGGCATCTTTGCCCTCGTCATGCAGGTCAGGCCCGAC
CTGGGCTGGCGAGACGTGCAGTATCTGGCCATGGAGACGGCCCAGCCCATCGCCGATCAGCCCGAGAGCTGGCAA
ACGACGAGCATCGGCAAGAGATACAGCCACTACTTTGGCTACGGTAAGATTGATAGCTATGCGCTTGTCGAGAGT
GCCAAGACGTGGACCAAGGTGAAGCCCCAGGCTTGGTTCTTTTCGCCCTGGATCCACGTCAAGACGGCCATACCA
GAGGGTGGCGACGGCTTGACAGCTCACTTCGAGGTCACGAGCGACATGATGAAGAAGGCCAACCTGGAGCGCGTC
GAGCACGTCACCATCACCATGAATGTGAATCACACTCGTCGCGGCGACCTCAGCGTCGACCTCGTCAGTCCGCAG
AACGTCGTGAGCCACATCGCGACGGCCAGGGCCCACGACAGCCACAATGGGGGCTACGTCGACTGGACCTTTATG
ACTGTCGTCCACTGGGGCGAGTCTGGTATCGGCAACTGGAGTCTGGTGGTCCATGACACGAAAGAGAACAAGCAC
CGCGGCACCTTTGTCGACTGGCGAATGAAGCTCTGGGGCGAGGCCATGGACGCCGGCGCTGCCTATAATCTGCCC
ATGCCCGAGACGACCGACGACGACGATCACGACAAGACGGTCTCGTCTGTTGCCGGACCCGTCGCCACCTCGGGC
GGCCGACCGAACCAGAAGCCCCCACCGCAGCCGACCATGACGGCCCTGCCAACGGATCACCCGGAACGTCCCACC
AAGCCCGGAGGCGCACAGCTGTCATCATCATCGCCCAGCGTGGTGTCGTCGCCCGCGGCCAAGGCGGGACCCTTC
TGGATCTACGGCGCCTTTAGCCTCATCGTCGTCTTCTGCGTCGGCCTGGGCGCGTATCTGTGGATCGCTCGCCGC
CGTCGGCTGAGGAACAAGGCGCGCGACAGTTACGAGTTCGAGCTCATCGACGAGGAGGAAACCGAGGCCATCAAC
GGACTCGAAAAGGACGCGGCCGGCGGTCAGCGAGGAGGACGACGCACCCGTGGCGGAGAGCTATATGACGCCTTT
GCCGGGAATAGCGAAGATGACGACGACGCCGATGACGACGACGACGACGATGGCACGGGTCAGGTGCGAGAGTAC
AGAGACGGATCGCAAGACAGGTTGACGCCATCGGATGAGACGGAGCAGTACGTCGTGGGCGAGGAGAGCGACGTC
TCCGACACCGAGGCCGTCTCGCCCACGGACTCGAAGTTACTGGGCGGCAGGGCTCCATGA
Transcript >Ophcf2|02598
ATGGCCTTTCGAGACTACAGTCTCTTCGACTTTTATGTCGTTCACCTCGCCGAGTCCGCTTCCCCGGAAGAAATC
GCCTCGGAGCTGGGCATGCGACTCGATGGCCGCCATTCACTACCCCATCACTACGTCTTACGGACGTCAAAGTCT
TCCGAGGACCAGCTACAGCAGCGCCTGACGAAGCGGAAGCTTATGAAGCGAGATGCTCAACAAGACCACATCGTT
CGCGATGTCCTGCTGGCTCGCAAACAAGAGCCGAGGATGCGACTGCACAAGCGCATCATCCCTCCCGGTCCGGCT
GCTGCCATGCGATCCCGCGCCTTGAAGTTGCCGCTCGACACGGCCACAGTCAAGAAGCAACAGGATGTCATGGGC
ACTCTCAACATCCACGACCCCATGTTTGAGGAGCAATGGCATCTACTCAACACGCGCCAGCCCGGCCACGACATC
AATGTCACGGGGCTATGGCTCGAGGGTATCACGGGCAAGGACGCGACAGTGGCCATCGTCGATGACGGTCTCGAC
ATGAGCAGCGACGACCTGAAAAACAATTACTTCGCCGCCGGCTCCTGGGATTTCAACGACAAGGGCGCCGAGCCC
CGTCCGCGCCTATCCGACGACAAGCACGGCACCCGCTGCGCCGGCGAGGTGGCAGCCGCCCGCAATGACGTTTGC
GGCGTCGGAGCTGCCTACGATGCTCGCGTCGCCGGCATTCGCATACTCAGCAAGCCCATCAGCGACGCCGACGAG
GCAGACGCCATGGTCTACAAGAACCAGGAGAACCAGATCTACTCGTGCTCGTGGGGACCCCGTGACGACGGCCGT
TCCATGGAGGCGCCCGGAATCCTCATTCAACGCGCCATCCTCCACGGAATCCAGGAGGGCCGCGGCGGCCTCGGT
TCCATCTTCGTCTTCGCCAGCGGCAACGGCGCCGCCAGCGACGATAACTGCAATTTTGACGGATACACAAACTCC
ATCTACAGCATCACTATAGGCGCCATCGACCGCGCCGGCCACCATCCCTACTACTCGGAGCTGTGCTCGGCCCAG
CTCGTCGTCACCTACAGCAGCGGAGACGGAGATTCCATCCACACCACCGATGTCGGCACGAACCAGTGCACCTCT
AGCCACGGCGGAACGTCGGCTGCCGCGCCCCTTGCCGCCGGCATCTTTGCCCTCGTCATGCAGGTCAGGCCCGAC
CTGGGCTGGCGAGACGTGCAGTATCTGGCCATGGAGACGGCCCAGCCCATCGCCGATCAGCCCGAGAGCTGGCAA
ACGACGAGCATCGGCAAGAGATACAGCCACTACTTTGGCTACGGTAAGATTGATAGCTATGCGCTTGTCGAGAGT
GCCAAGACGTGGACCAAGGTGAAGCCCCAGGCTTGGTTCTTTTCGCCCTGGATCCACGTCAAGACGGCCATACCA
GAGGGTGGCGACGGCTTGACAGCTCACTTCGAGGTCACGAGCGACATGATGAAGAAGGCCAACCTGGAGCGCGTC
GAGCACGTCACCATCACCATGAATGTGAATCACACTCGTCGCGGCGACCTCAGCGTCGACCTCGTCAGTCCGCAG
AACGTCGTGAGCCACATCGCGACGGCCAGGGCCCACGACAGCCACAATGGGGGCTACGTCGACTGGACCTTTATG
ACTGTCGTCCACTGGGGCGAGTCTGGTATCGGCAACTGGAGTCTGGTGGTCCATGACACGAAAGAGAACAAGCAC
CGCGGCACCTTTGTCGACTGGCGAATGAAGCTCTGGGGCGAGGCCATGGACGCCGGCGCTGCCTATAATCTGCCC
ATGCCCGAGACGACCGACGACGACGATCACGACAAGACGGTCTCGTCTGTTGCCGGACCCGTCGCCACCTCGGGC
GGCCGACCGAACCAGAAGCCCCCACCGCAGCCGACCATGACGGCCCTGCCAACGGATCACCCGGAACGTCCCACC
AAGCCCGGAGGCGCACAGCTGTCATCATCATCGCCCAGCGTGGTGTCGTCGCCCGCGGCCAAGGCGGGACCCTTC
TGGATCTACGGCGCCTTTAGCCTCATCGTCGTCTTCTGCGTCGGCCTGGGCGCGTATCTGTGGATCGCTCGCCGC
CGTCGGCTGAGGAACAAGGCGCGCGACAGTTACGAGTTCGAGCTCATCGACGAGGAGGAAACCGAGGCCATCAAC
GGACTCGAAAAGGACGCGGCCGGCGGTCAGCGAGGAGGACGACGCACCCGTGGCGGAGAGCTATATGACGCCTTT
GCCGGGAATAGCGAAGATGACGACGACGCCGATGACGACGACGACGACGATGGCACGGGTCAGGTGCGAGAGTAC
AGAGACGGATCGCAAGACAGGTTGACGCCATCGGATGAGACGGAGCAGTACGTCGTGGGCGAGGAGAGCGACGTC
TCCGACACCGAGGCCGTCTCGCCCACGGACTCGAAGTTACTGGGCGGCAGGGCTCCATGA
Gene >Ophcf2|02598
ATGGCCTTTCGAGACTACAGTCTCTTCGACTTTTATGTCGTTCACCTCGCCGAGTCCGCTTCCCCGGAAGAAATC
GCCTCGGAGCTGGGCATGCGACTCGATGGCCGCCATTCACTACCCCATCACTACGTCTTACGGACGTCAAAGTCT
TCCGAGGACCAGCTACAGCAGCGCCTGACGAAGCGGAAGCTTATGAAGCGAGATGCTCAACAAGACCACATCGTT
CGCGATGTCCTGCTGGCTCGCAAACAAGAGCCGAGGATGCGACTGCACAAGCGCATCATCCCTCCCGGTCCGGCT
GCTGCCATGCGATCCCGCGCCTTGAAGTTGCCGCTCGACACGGCCACAGTCAAGAAGCAACAGGATGTCATGGGC
ACTCTCAACATCCACGACCCCATGTTTGAGGAGCAATGGCATCTACTCAACACGCGCCAGCCCGGCCACGACATC
AATGTCACGGGGCTATGGCTCGAGGGTATCACGGGCAAGGACGCGACAGTGGCCATCGTCGATGACGGTCTCGAC
ATGAGCAGCGACGACCTGAAAAACAATTACTTCGCCGCCGGCTCCTGGGATTTCAACGACAAGGGCGCCGAGCCC
CGTCCGCGCCTATCCGACGACAAGCACGGCACCCGCTGCGCCGGCGAGGTGGCAGCCGCCCGCAATGACGTTTGC
GGCGTCGGAGCTGCCTACGATGCTCGCGTCGCCGGCATTCGCATACTCAGCAAGCCCATCAGCGACGCCGACGAG
GCAGACGCCATGGTCTACAAGAACCAGGAGAACCAGATCTACTCGTGCTCGTGGGGACCCCGTGACGACGGCCGT
TCCATGGAGGCGCCCGGAATCCTCATTCAACGCGCCATCCTCCACGGAATCCAGGAGGGCCGCGGCGGCCTCGGT
TCCATCTTCGTCTTCGCCAGCGGCAACGGCGCCGCCAGCGACGATAACTGCAATTTTGACGGATACACAAACTCC
ATCTACAGCATCACTATAGGCGCCATCGACCGCGCCGGCCACCATCCCTACTACTCGGAGCTGTGCTCGGCCCAG
CTCGTCGTCACCTACAGCAGCGGAGACGGAGATTCCATCGTGCGTCTTTCTGTCTTCCCCCTTCGGTAGACGACC
AGTGCTGACCCTCCTCGACTCTACTCGCAGCACACCACCGATGTCGGCACGAACCAGTGCACCTCTAGCCACGGC
GGAACGTCGGCTGCCGCGCCCCTTGCCGCCGGCATCTTTGCCCTCGTCATGCAGGTCAGGCCCGACCTGGGCTGG
CGAGACGTGCAGTATCTGGCCATGGAGACGGCCCAGCCCATCGCCGATCAGCCCGAGAGCTGGCAAACGACGAGC
ATCGGCAAGAGATACAGCCACTACTTTGGCTACGGTAAGATTGATAGCTATGCGCTTGTCGAGAGTGCCAAGACG
TGGACCAAGGTGAAGCCCCAGGCTTGGTTCTTTTCGCCCTGGATCCACGTCAAGACGGCCATACCAGAGGGTGGC
GACGGCTTGACAGCTCACTTCGAGGTCACGAGCGACATGATGAAGAAGGCCAACCTGGAGCGCGTCGAGCACGTC
ACCATCACCATGAATGTGAATCACACTCGTCGCGGCGACCTCAGCGTCGACCTCGTCAGTCCGCAGAACGTCGTG
AGCCACATCGCGACGGCCAGGGCCCACGACAGCCACAATGGGGGCTACGTCGACTGGACCTTTATGACTGTCGTC
CACTGGTGAGTCTAATACCGTCCCCGATCCTGCCCCCGTGCTGACATTCCTGTTCTTCGTAGGGGCGAGTCTGGT
ATCGGCAACTGGAGTCTGGTGGTCCATGACACGAAAGAGAACAAGCACCGCGGCACCTTTGTCGACTGGCGAATG
AAGCTCTGGGGCGAGGCCATGGACGCCGGCGCTGCCTATAATCTGCCCATGCCCGAGACGACCGACGACGACGAT
CACGACAAGACGGTCTCGTCTGTTGCCGGACCCGTCGCCACCTCGGGCGGCCGACCGAACCAGAAGCCCCCACCG
CAGCCGACCATGACGGCCCTGCCAACGGATCACCCGGAACGTCCCACCAAGCCCGGAGGCGCACAGCTGTCATCA
TCATCGCCCAGCGTGGTGTCGTCGCCCGCGGCCAAGGCGGGACCCTTCTGGATCTACGGCGCCTTTAGCCTCATC
GTCGTCTTCTGCGTCGGCCTGGGCGCGTATCTGTGGATCGCTCGCCGCCGTCGGCTGAGGAACAAGGCGCGCGAC
AGTTACGAGTTCGAGCTCATCGACGAGGAGGAAACCGAGGCCATCAACGGACTCGAAAAGGACGCGGCCGGCGGT
CAGCGAGGAGGACGACGCACCCGTGGCGGAGAGCTATATGACGCCTTTGCCGGGAATAGCGAAGATGACGACGAC
GCCGATGACGACGACGACGACGATGGCACGGGTCAGGTGCGAGAGTACAGAGACGGATCGCAAGACAGGTTGACG
CCATCGGATGAGACGGAGCAGTACGTCGTGGGCGAGGAGAGCGACGTCTCCGACACCGAGGCCGTCTCGCCCACG
GACTCGAAGTTACTGGGCGGCAGGGCTCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail