Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02596
Gene name
Locationscaffold_02:4164286..4165897
Strand+
Gene length (bp)1611
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07766 LETM1_RBD LETM1-like, RBD 3.9E-87 184 413

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 199 221 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 130.56 71.47 189.64
Alive In ants, during behavior modification 66.80 38.37 95.23
Dead In ants, recently dead 50.02 28.40 71.64

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.072786 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02596
MSASSAVVRTAAARNPLLVGSALPRAFAPGWLARRDARIPALAVFFRSMATEHHGPDHQTTTSTTAPPPGFSVER
AKKPLARDDDGLTATKQPQSQLQQQKQAAAQKQAGATKTEAAVLQLAAEKGDAAEKQELAKTDQEDKKLTLWQKV
KREAHHYWDGTKLLAAEVRISWKLALKMAAGYDLSRRENKQLQRTVRDLGRLVPFSVFIIVPLGEALLPLALKLF
PNMLPSTFEGQKSKDAKASLLRSTRNEVSAFLKQTLKETGLPLSAATAHKEEFANFFRKVRSTGETPTRQDVIRV
CKVFRDDVTLDNLSRPQLVSMCRYMNLNTFGTDMMLRYQVRHRMRQIKRDDKAISFEGIDSLTVSELQTACAARG
IRTHSVSPARMRTDLQTWLDLRLKEGVPSTLLVLSNAYMYGQGSDSEWNQVDALIGVLSSIPEELFHEMELEVHN
AEGAATNKQRLEVLKEQEDLIEDENEQNEESQSTGMATPRDVEDIDEKEERQISARAAGLEKTPAAEMVDAERET
AARNNKRGKTE*
Coding >Ophcf2|02596
ATGAGTGCCTCGTCTGCGGTTGTCCGCACGGCGGCGGCTCGCAACCCGCTGCTGGTGGGAAGCGCCCTTCCGCGA
GCCTTTGCGCCTGGCTGGCTGGCCCGCCGCGATGCTCGAATCCCGGCGCTGGCCGTATTTTTCCGTTCCATGGCT
ACCGAGCATCACGGGCCGGATCACCAGACGACGACGTCGACGACGGCGCCTCCGCCCGGCTTCAGTGTTGAGCGT
GCTAAGAAGCCGCTGGCTCGGGACGACGACGGCTTGACTGCGACCAAGCAGCCTCAGTCTCAGCTTCAGCAGCAG
AAGCAGGCGGCTGCACAAAAACAAGCCGGCGCGACAAAGACCGAGGCAGCCGTTCTGCAGCTGGCTGCGGAAAAG
GGCGACGCGGCAGAGAAGCAGGAGCTCGCCAAAACCGACCAGGAAGACAAGAAGCTCACGTTGTGGCAAAAAGTC
AAGAGGGAGGCGCACCACTACTGGGACGGCACCAAGCTGCTCGCCGCCGAGGTCCGAATCAGCTGGAAGCTGGCG
CTCAAGATGGCGGCCGGCTACGATCTCTCGCGCAGAGAAAACAAGCAGCTGCAGCGGACGGTGCGGGATCTCGGC
CGGCTGGTGCCGTTTTCCGTCTTCATCATCGTGCCCCTAGGCGAGGCTCTACTACCGCTCGCCCTCAAGCTCTTC
CCCAATATGCTGCCCAGCACGTTCGAGGGTCAAAAGTCAAAGGACGCAAAGGCCAGCCTGCTACGGTCTACGCGC
AACGAGGTCAGCGCCTTCCTCAAGCAGACGCTCAAGGAGACGGGTCTGCCGCTGAGCGCGGCCACGGCGCACAAG
GAGGAGTTTGCCAACTTCTTCCGCAAGGTGCGCTCGACGGGCGAGACGCCGACGCGGCAGGACGTGATCCGGGTC
TGCAAGGTGTTCCGCGATGACGTGACTCTCGACAACTTGTCGCGGCCGCAGCTCGTGTCCATGTGCAGGTACATG
AACCTCAACACGTTTGGGACCGACATGATGCTGCGCTACCAGGTGCGGCACCGGATGCGGCAGATCAAGCGCGAC
GACAAGGCCATAAGCTTCGAGGGCATCGACAGCCTGACCGTGTCGGAGCTGCAGACGGCGTGCGCGGCCCGAGGC
ATCCGCACTCACAGCGTGTCCCCGGCCCGGATGCGGACCGACCTGCAGACGTGGCTGGACCTGCGACTGAAGGAG
GGCGTGCCGTCGACGCTGCTGGTGCTCAGCAACGCCTACATGTACGGCCAGGGCTCCGACTCGGAGTGGAACCAG
GTGGACGCCCTCATCGGCGTGCTGTCGTCCATCCCCGAGGAGCTCTTCCACGAGATGGAGCTCGAGGTGCACAAC
GCCGAGGGCGCGGCCACCAACAAGCAGCGGCTCGAGGTTCTCAAGGAGCAGGAGGACCTGATCGAGGACGAGAAC
GAGCAGAACGAGGAGAGCCAGAGCACGGGCATGGCGACGCCGCGTGACGTCGAAGACATTGACGAGAAGGAGGAG
CGTCAGATATCGGCGCGGGCGGCGGGACTGGAGAAGACGCCTGCAGCTGAGATGGTTGACGCCGAGCGGGAGACG
GCGGCCCGGAACAATAAAAGGGGGAAGACGGAGTGA
Transcript >Ophcf2|02596
ATGAGTGCCTCGTCTGCGGTTGTCCGCACGGCGGCGGCTCGCAACCCGCTGCTGGTGGGAAGCGCCCTTCCGCGA
GCCTTTGCGCCTGGCTGGCTGGCCCGCCGCGATGCTCGAATCCCGGCGCTGGCCGTATTTTTCCGTTCCATGGCT
ACCGAGCATCACGGGCCGGATCACCAGACGACGACGTCGACGACGGCGCCTCCGCCCGGCTTCAGTGTTGAGCGT
GCTAAGAAGCCGCTGGCTCGGGACGACGACGGCTTGACTGCGACCAAGCAGCCTCAGTCTCAGCTTCAGCAGCAG
AAGCAGGCGGCTGCACAAAAACAAGCCGGCGCGACAAAGACCGAGGCAGCCGTTCTGCAGCTGGCTGCGGAAAAG
GGCGACGCGGCAGAGAAGCAGGAGCTCGCCAAAACCGACCAGGAAGACAAGAAGCTCACGTTGTGGCAAAAAGTC
AAGAGGGAGGCGCACCACTACTGGGACGGCACCAAGCTGCTCGCCGCCGAGGTCCGAATCAGCTGGAAGCTGGCG
CTCAAGATGGCGGCCGGCTACGATCTCTCGCGCAGAGAAAACAAGCAGCTGCAGCGGACGGTGCGGGATCTCGGC
CGGCTGGTGCCGTTTTCCGTCTTCATCATCGTGCCCCTAGGCGAGGCTCTACTACCGCTCGCCCTCAAGCTCTTC
CCCAATATGCTGCCCAGCACGTTCGAGGGTCAAAAGTCAAAGGACGCAAAGGCCAGCCTGCTACGGTCTACGCGC
AACGAGGTCAGCGCCTTCCTCAAGCAGACGCTCAAGGAGACGGGTCTGCCGCTGAGCGCGGCCACGGCGCACAAG
GAGGAGTTTGCCAACTTCTTCCGCAAGGTGCGCTCGACGGGCGAGACGCCGACGCGGCAGGACGTGATCCGGGTC
TGCAAGGTGTTCCGCGATGACGTGACTCTCGACAACTTGTCGCGGCCGCAGCTCGTGTCCATGTGCAGGTACATG
AACCTCAACACGTTTGGGACCGACATGATGCTGCGCTACCAGGTGCGGCACCGGATGCGGCAGATCAAGCGCGAC
GACAAGGCCATAAGCTTCGAGGGCATCGACAGCCTGACCGTGTCGGAGCTGCAGACGGCGTGCGCGGCCCGAGGC
ATCCGCACTCACAGCGTGTCCCCGGCCCGGATGCGGACCGACCTGCAGACGTGGCTGGACCTGCGACTGAAGGAG
GGCGTGCCGTCGACGCTGCTGGTGCTCAGCAACGCCTACATGTACGGCCAGGGCTCCGACTCGGAGTGGAACCAG
GTGGACGCCCTCATCGGCGTGCTGTCGTCCATCCCCGAGGAGCTCTTCCACGAGATGGAGCTCGAGGTGCACAAC
GCCGAGGGCGCGGCCACCAACAAGCAGCGGCTCGAGGTTCTCAAGGAGCAGGAGGACCTGATCGAGGACGAGAAC
GAGCAGAACGAGGAGAGCCAGAGCACGGGCATGGCGACGCCGCGTGACGTCGAAGACATTGACGAGAAGGAGGAG
CGTCAGATATCGGCGCGGGCGGCGGGACTGGAGAAGACGCCTGCAGCTGAGATGGTTGACGCCGAGCGGGAGACG
GCGGCCCGGAACAATAAAAGGGGGAAGACGGAGTGA
Gene >Ophcf2|02596
ATGAGTGCCTCGTCTGCGGTTGTCCGCACGGCGGCGGCTCGCAACCCGCTGCTGGTGGGAAGCGCCCTTCCGCGA
GCCTTTGCGCCTGGCTGGCTGGCCCGCCGCGATGCTCGAATCCCGGCGCTGGCCGTATTTTTCCGTTCCATGGCT
ACCGAGCATCACGGGCCGGATCACCAGACGACGACGTCGACGACGGCGCCTCCGCCCGGCTTCAGTGTTGAGCGT
GCTAAGAAGCCGCTGGCTCGGGACGACGACGGCTTGACTGCGACCAAGCAGCCTCAGTCTCAGCTTCAGCAGCAG
AAGCAGGCGGCTGCACAAAAACAAGCCGGCGCGACAAAGACCGAGGCAGCCGTTCTGCAGCTGGCTGCGGAAAAG
GGCGACGCGGCAGAGAAGCAGGAGCTCGCCAAAACCGACCAGGAAGACAAGAAGCTCACGTTGTGGCAAAAAGTC
AAGAGGGAGGCGCACCACTACTGGGACGGCACCAAGCTGCTCGCCGCCGAGGTCCGAATCAGCTGGAAGCTGGCG
CTCAAGATGGCGGCCGGCTACGATCTCTCGCGCAGAGAAAACAAGCAGCTGCAGCGGACGGTGCGGGATCTCGGC
CGGCTGGTGCCGTTTTCCGTCTTCATCATCGTGCCCCTAGGCGAGGCTCTACTACCGCTCGCCCTCAAGCTCTTC
CCCAATATGCTGCCCAGCACGTTCGAGGGTCAAAAGTCAAAGGACGCAAAGGCCAGCCTGCTACGGTCTACGCGC
AACGAGGTCAGCGCCTTCCTCAAGCAGACGCTCAAGGAGACGGGTCTGCCGCTGAGCGCGGCCACGGCGCACAAG
GAGGAGTTTGCCAACTTCTTCCGCAAGGTGCGCTCGACGGGCGAGACGCCGACGCGGCAGGACGTGATCCGGGTC
TGCAAGGTGTTCCGCGATGACGTGACTCTCGACAACTTGTCGCGGCCGCAGCTCGTGTCCATGTGCAGGTACATG
AACCTCAACACGTTTGGGACCGACATGATGCTGCGCTACCAGGTGCGGCACCGGATGCGGCAGATCAAGCGCGAC
GACAAGGCCATAAGCTTCGAGGGCATCGACAGCCTGACCGTGTCGGAGCTGCAGACGGCGTGCGCGGCCCGAGGC
ATCCGCACTCACAGCGTGTCCCCGGCCCGGATGCGGACCGACCTGCAGACGTGGCTGGACCTGCGACTGAAGGAG
GGCGTGCCGTCGACGCTGCTGGTGCTCAGCAACGCCTACATGTACGGCCAGGGCTCCGACTCGGAGTGGAACCAG
GTGGACGCCCTCATCGGCGTGCTGTCGTCCATCCCCGAGGAGCTCTTCCACGAGATGGAGCTCGAGGTGCACAAC
GCCGAGGGCGCGGCCACCAACAAGCAGCGGCTCGAGGTTCTCAAGGAGCAGGAGGACCTGATCGAGGACGAGAAC
GAGCAGAACGAGGAGAGCCAGAGCACGGGCATGGCGACGCCGCGTGACGTCGAAGACATTGACGAGAAGGAGGAG
CGTCAGATATCGGCGCGGGCGGCGGGACTGGAGAAGACGCCTGCAGCTGAGATGGTTGACGCCGAGCGGGAGACG
GCGGCCCGGAACAATAAAAGGGGGAAGACGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail