Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02593
Gene name
Locationscaffold_02:4157155..4158316
Strand+
Gene length (bp)1161
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00810 ER_lumen_recept ER lumen protein retaining receptor 4.4E-41 31 175

GO

GO Term Description Terminal node
GO:0006621 protein retention in ER lumen Yes
GO:0046923 ER retention sequence binding Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0051235 maintenance of location No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0042277 peptide binding No
GO:0072595 maintenance of protein localization in organelle No
GO:0035437 maintenance of protein localization in endoplasmic reticulum No
GO:0033218 amide binding No
GO:0005488 binding No
GO:0051651 maintenance of location in cell No
GO:0005048 signal sequence binding No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0045185 maintenance of protein location No
GO:0032507 maintenance of protein location in cell No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 97 119 22
3 155 174 19
4 184 206 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 158.12 89.44 226.79
Alive In ants, during behavior modification 77.19 42.62 111.76
Dead In ants, recently dead 108.32 62.16 154.48

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.032627 yes
Dead Fungus 0.038268 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02593
MTAWNIFRILGDLSHALSKCILITSMHRNRSAEGVSFITQALYALVFCTRYLDIFMERSVWNLLFKIFYILSSFY
ILAVMQWVLPRSRERELSWKLGAAVLGGSLFLSPFMMLMFERVWSFRSWLWVFSEILESVCVLPQLLLLRQTTVP
TVIDSFYLFALGSYRALYCLNWFLREFDDRKPDAVSVIFGLVQTALYGDFAWVYYTRQRVKLRAGGLVDADDMRR
GWLLRRIFGKNVDAGDDEENAPSLGVHGDDARRTTRPKWGARGISVSADEGVLDTERHNRADAEGLDDAADPDAK
MRDPDELARALDDDDDDDDAAPGASTASQIQGQGRGMPRDMKSGDEWRD*
Coding >Ophcf2|02593
ATGACGGCTTGGAACATCTTCCGCATCCTGGGCGACTTGTCCCACGCTCTCTCCAAATGCATCCTCATCACAAGC
ATGCACCGCAATCGCAGCGCCGAGGGCGTCTCTTTCATCACACAGGCGCTCTACGCCCTCGTCTTCTGCACCCGC
TACCTCGACATCTTCATGGAGCGCTCGGTCTGGAACTTGCTCTTCAAAATCTTCTACATCCTATCCTCTTTCTAC
ATCCTGGCCGTCATGCAATGGGTTCTCCCTCGATCTCGGGAGCGCGAGCTGTCTTGGAAACTGGGCGCCGCCGTC
CTTGGCGGTTCGTTGTTCCTATCGCCCTTCATGATGCTCATGTTTGAGCGTGTATGGAGCTTCCGATCTTGGCTG
TGGGTATTTTCCGAGATCCTCGAATCCGTCTGCGTCCTTCCACAGCTCCTACTTCTCCGGCAGACCACGGTTCCC
ACCGTCATCGACTCCTTTTACCTCTTCGCACTAGGTTCCTACAGGGCCCTCTACTGCCTCAACTGGTTCCTTCGA
GAGTTTGACGACCGCAAACCCGACGCCGTCTCCGTCATCTTTGGCCTCGTGCAGACGGCTCTTTACGGCGACTTT
GCTTGGGTCTACTACACGCGCCAGAGGGTCAAGCTGCGTGCCGGCGGGCTCGTCGACGCCGACGACATGCGCCGA
GGCTGGCTACTGCGTCGAATCTTTGGCAAAAATGTCGACGCTGGCGATGACGAAGAGAATGCGCCATCGTTGGGA
GTCCATGGCGATGACGCCAGACGAACAACCCGGCCTAAATGGGGGGCGCGTGGAATTTCCGTGAGCGCCGATGAG
GGCGTGCTCGATACCGAGCGACATAATCGTGCCGATGCCGAGGGCTTGGATGACGCTGCAGACCCAGACGCCAAG
ATGCGAGATCCAGACGAGCTTGCCAGGGCGCTGGATGACGACGACGATGACGATGACGCCGCTCCCGGGGCTTCA
ACGGCGTCGCAAATTCAGGGACAGGGACGGGGAATGCCACGCGATATGAAGAGCGGTGACGAATGGCGAGATTGA
Transcript >Ophcf2|02593
ATGACGGCTTGGAACATCTTCCGCATCCTGGGCGACTTGTCCCACGCTCTCTCCAAATGCATCCTCATCACAAGC
ATGCACCGCAATCGCAGCGCCGAGGGCGTCTCTTTCATCACACAGGCGCTCTACGCCCTCGTCTTCTGCACCCGC
TACCTCGACATCTTCATGGAGCGCTCGGTCTGGAACTTGCTCTTCAAAATCTTCTACATCCTATCCTCTTTCTAC
ATCCTGGCCGTCATGCAATGGGTTCTCCCTCGATCTCGGGAGCGCGAGCTGTCTTGGAAACTGGGCGCCGCCGTC
CTTGGCGGTTCGTTGTTCCTATCGCCCTTCATGATGCTCATGTTTGAGCGTGTATGGAGCTTCCGATCTTGGCTG
TGGGTATTTTCCGAGATCCTCGAATCCGTCTGCGTCCTTCCACAGCTCCTACTTCTCCGGCAGACCACGGTTCCC
ACCGTCATCGACTCCTTTTACCTCTTCGCACTAGGTTCCTACAGGGCCCTCTACTGCCTCAACTGGTTCCTTCGA
GAGTTTGACGACCGCAAACCCGACGCCGTCTCCGTCATCTTTGGCCTCGTGCAGACGGCTCTTTACGGCGACTTT
GCTTGGGTCTACTACACGCGCCAGAGGGTCAAGCTGCGTGCCGGCGGGCTCGTCGACGCCGACGACATGCGCCGA
GGCTGGCTACTGCGTCGAATCTTTGGCAAAAATGTCGACGCTGGCGATGACGAAGAGAATGCGCCATCGTTGGGA
GTCCATGGCGATGACGCCAGACGAACAACCCGGCCTAAATGGGGGGCGCGTGGAATTTCCGTGAGCGCCGATGAG
GGCGTGCTCGATACCGAGCGACATAATCGTGCCGATGCCGAGGGCTTGGATGACGCTGCAGACCCAGACGCCAAG
ATGCGAGATCCAGACGAGCTTGCCAGGGCGCTGGATGACGACGACGATGACGATGACGCCGCTCCCGGGGCTTCA
ACGGCGTCGCAAATTCAGGGACAGGGACGGGGAATGCCACGCGATATGAAGAGCGGTGACGAATGGCGAGATTGA
Gene >Ophcf2|02593
ATGACGGCTTGGAACGTGCGTCGTCGCAATGTCTTTACGATGGCATCGCTGACGCATTCGTTATATTCCACAGAT
CTTCCGCATCCTGGGCGACTTGTCCCACGCTCTCTCCAAATGCATCCTCATCACAAGCATGCACCGCAATCGCAG
CGCCGAGGGCGTCTCTTTCATCACACAGGCGCTCTACGCCCTCGTCTTCTGCACCCGCTACCTCGACATCTTCAT
GGAGCGCTCGGTCTGGAACTTGCTCTTCAAAATCTTCTACATCCTATCCTCTTTCTACATCCTGGCCGTCATGCA
ATGGGTTCTCCCTCGATCTCGGGAGCGCGAGCTGTCTTGGAAACTGGGCGCCGCCGTCCTTGGCGGTTCGTTGTT
CCTATCGCCCTTCATGATGCTCATGTTTGAGCGTGTATGGAGCTTCCGATCTGTGAGTCTACGTCCATATATCGT
CTGTCCCGGCGCTGGCTGAAGTCGACAAAGTGGCTGTGGGTATTTTCCGAGATCCTCGAATCCGTCTGCGTCCTT
CCACAGCTCCTACTTCTCCGGCAGACCACGGTTCCCACCGTCATCGACTCCTTTTACCTCTTCGCACTAGGTTCC
TACAGGGCCCTCTACTGCCTCAACTGGTTCCTTCGAGAGTTTGACGACCGCAAACCCGACGCCGTCTCCGTCATC
TTTGGCCTCGTGCAGACGGCTCTTTACGGCGACTTTGCTTGGGTCTACTACACGCGCCAGAGGGTCAAGCTGCGT
GCCGGCGGGCTCGTCGACGCCGACGACATGCGCCGAGGCTGGCTACTGCGTCGAATCTTTGGCAAAAATGTCGAC
GCTGGCGATGACGAAGAGAATGCGCCATCGTTGGGAGTCCATGGCGATGACGCCAGACGAACAACCCGGCCTAAA
TGGGGGGCGCGTGGAATTTCCGTGAGCGCCGATGAGGGCGTGCTCGATACCGAGCGACATAATCGTGCCGATGCC
GAGGGCTTGGATGACGCTGCAGACCCAGACGCCAAGATGCGAGATCCAGACGAGCTTGCCAGGGCGCTGGATGAC
GACGACGATGACGATGACGCCGCTCCCGGGGCTTCAACGGCGTCGCAAATTCAGGGACAGGGACGGGGAATGCCA
CGCGATATGAAGAGCGGTGACGAATGGCGAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail