Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02591
Gene name
Locationscaffold_02:4154452..4155531
Strand-
Gene length (bp)1079
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04991 LicD LicD family 4.8E-17 77 179
PF04991 LicD LicD family 7.4E-07 192 233

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2232 0.0697 0.7434 0.1018 0.0929 0.0147 0.3642 0.2923 0.1481 0.0021

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999593

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2732
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5643
Ophiocordyceps australis map64 (Brazil) OphauB2|7893
Ophiocordyceps camponoti-floridani Ophcf2|02591 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4154
Ophiocordyceps kimflemingae Ophio5|8052
Ophiocordyceps subramaniannii Hirsu2|4307

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02591
MVMKGLCFFALLLAAAAASLSKRDAVPLDENLYPEPKYFKEAFGYAHYDARFMTQALDEEPHRDVLRILIQTYLA
TCRALKVKTWLMHGTLLGWWWGKKIMPWDKDADVQVTEVDLYHLAAHYNKTVYYYKYGDMEQGRYFLLDVNPHFD
HRETDDALNLIDARWIDMATGLFIDITAARYHLEHPAGEGILYDKNEHEFRDTYVYPLRNTTFEGVQAMIPYRYK
EMLESEYGKEALTETAFNGYVFDIENQQWVRKGDDDGDRVDLRRGEKA*
Coding >Ophcf2|02591
ATGGTGATGAAGGGGCTGTGCTTTTTCGCGCTGCTGCTGGCTGCGGCTGCTGCGAGCCTGTCCAAGAGGGATGCG
GTGCCGCTGGATGAGAATCTCTATCCCGAGCCCAAGTATTTCAAAGAGGCTTTCGGCTATGCGCACTATGACGCG
CGCTTCATGACCCAAGCGCTCGATGAGGAGCCTCACCGGGACGTGCTGCGGATCCTCATCCAGACCTACTTGGCG
ACCTGTCGCGCACTCAAGGTCAAGACGTGGCTCATGCATGGAACTCTCCTCGGTTGGTGGTGGGGGAAAAAGATT
ATGCCCTGGGATAAGGATGCCGACGTGCAGGTAACAGAGGTGGACCTGTACCATTTAGCCGCGCACTACAACAAG
ACGGTTTACTACTACAAGTACGGCGATATGGAGCAAGGCCGCTACTTCTTGCTCGACGTCAATCCGCACTTTGAT
CATCGCGAGACAGACGATGCGCTCAATCTCATTGACGCCCGCTGGATCGACATGGCCACGGGCCTGTTCATCGAT
ATTACCGCCGCGAGGTATCACCTGGAACATCCGGCCGGCGAGGGTATTCTCTACGACAAGAACGAACACGAGTTT
CGGGACACGTATGTGTATCCGTTGAGGAACACGACGTTCGAAGGTGTTCAGGCCATGATTCCCTATCGTTACAAG
GAAATGCTCGAGTCTGAGTACGGCAAGGAGGCTTTGACGGAGACTGCGTTCAACGGCTATGTCTTTGATATCGAG
AATCAGCAGTGGGTGCGCAAGGGTGATGACGACGGAGACAGAGTTGATCTGCGCAGGGGTGAAAAGGCGTAG
Transcript >Ophcf2|02591
ATGGTGATGAAGGGGCTGTGCTTTTTCGCGCTGCTGCTGGCTGCGGCTGCTGCGAGCCTGTCCAAGAGGGATGCG
GTGCCGCTGGATGAGAATCTCTATCCCGAGCCCAAGTATTTCAAAGAGGCTTTCGGCTATGCGCACTATGACGCG
CGCTTCATGACCCAAGCGCTCGATGAGGAGCCTCACCGGGACGTGCTGCGGATCCTCATCCAGACCTACTTGGCG
ACCTGTCGCGCACTCAAGGTCAAGACGTGGCTCATGCATGGAACTCTCCTCGGTTGGTGGTGGGGGAAAAAGATT
ATGCCCTGGGATAAGGATGCCGACGTGCAGGTAACAGAGGTGGACCTGTACCATTTAGCCGCGCACTACAACAAG
ACGGTTTACTACTACAAGTACGGCGATATGGAGCAAGGCCGCTACTTCTTGCTCGACGTCAATCCGCACTTTGAT
CATCGCGAGACAGACGATGCGCTCAATCTCATTGACGCCCGCTGGATCGACATGGCCACGGGCCTGTTCATCGAT
ATTACCGCCGCGAGGTATCACCTGGAACATCCGGCCGGCGAGGGTATTCTCTACGACAAGAACGAACACGAGTTT
CGGGACACGTATGTGTATCCGTTGAGGAACACGACGTTCGAAGGTGTTCAGGCCATGATTCCCTATCGTTACAAG
GAAATGCTCGAGTCTGAGTACGGCAAGGAGGCTTTGACGGAGACTGCGTTCAACGGCTATGTCTTTGATATCGAG
AATCAGCAGTGGGTGCGCAAGGGTGATGACGACGGAGACAGAGTTGATCTGCGCAGGGGTGAAAAGGCGTAG
Gene >Ophcf2|02591
ATGGTGATGAAGGGGCTGTGCTTTTTCGCGCTGCTGCTGGCTGCGGCTGCTGCGAGCCTGTCCAAGAGGGATGCG
GTGCCGCTGGATGAGAATCTCTATCCCGAGCCCAAGTATTTCAGTGAGTGTTTGTTTACCTTGCGACGGCTCGGG
CCCTCTGCTAACCATGCGACGTAGAAGAGGCTTTGTACGTCTCGTCGTACCCGATGCGCGTCCTCGCTGACGGCT
CCCAGCGGCTATGCGCACTATGACGCGCGCTTCATGACCCAAGCGCTCGATGAGGAGCCTCACCGGGACGTGCTG
CGGATCCTCATCCAGACCTACTTGGCGACCTGTCGCGCACTCAAGGTCAAGACGTGGCTCATGCATGGAACTCTC
CTCGGTTGGTGGTGGGGGAAAAAGGCTCGTCTTTACCGGCCATGATGAGCTTTCCTCGCTGACGGTCTTCAGATT
ATGCCCTGGGATAAGGATGCCGACGTGCAGGTAACAGAGGTGGACCTGTACCATTTAGCCGCGCACTACAACAAG
ACGGTTTACTACTACAAGTACGGCGATATGGAGCAAGGCCGCTACTTCTTGCTCGACGTCAATCCGCACTTTGAT
CATCGCGAGACAGACGATGCGCTCAATCTCATTGACGCCCGCTGGATCGACATGGCCACGGGCCTGTTCATCGAT
ATTACCGCCGCGAGGTATCACCTGGAACATCCGGCCGGCGAGGGTATTCTCTACGACAAGAACGAACACGAGTTT
CGGGTGAGCCTTGTGCCCGCCTGTGCAAGACGACAAGGGCTAACAACGGGGGCAGGACACGTATGTGTATCCGTT
GAGGAACACGACGTTCGAAGGTGTTCAGGCCATGATTCCCTATCGTTACAAGGAAATGCTCGAGTCTGAGTACGG
CAAGGAGGCTTTGACGGAGACTGCGTTCAACGGGTAGGTTATGGCTTGGAGACGACGGGTTGGCTGTGGTTCTGA
CTTGGTCGTGCAGCTATGTCTTTGATATCGAGAATCAGCAGTGGGTGCGCAAGGGTGATGACGACGGAGACAGAG
TTGATCTGCGCAGGGGTGAAAAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail