Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02587
Gene name
Locationscaffold_02:4147301..4149270
Strand+
Gene length (bp)1969
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07651 ANTH ANTH domain 3.3E-68 5 262
PF01417 ENTH ENTH domain 1.9E-10 3 115

GO

GO Term Description Terminal node
GO:0005543 phospholipid binding Yes
GO:0005488 binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5897 0.2103 0.0271 0.2521 0.0404 0.0019 0.0637 0.4099 0.3573 0.0024

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3877
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5647
Ophiocordyceps australis map64 (Brazil) OphauB2|7889
Ophiocordyceps camponoti-floridani Ophcf2|02587 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4151
Ophiocordyceps kimflemingae Ophio5|8056
Ophiocordyceps subramaniannii Hirsu2|7692

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02587
MSSSFEKSVKGATKIKNAPPKNKYIEHILVATHAGEAGTGEVFRALQHRLRDSTWTVVLKSLIVIHLMIREGSPD
VALSYLARNRNILALGHFSDAQTQGRNIRHYASYLFERAKAYRDTKTDWVRAPESRLERLSVDKGLLRETEVVQT
QLQALVNCDVLESEPQNDITVLVFRLLVLDLLALFQMLNQGLINILGHFFEMSKPDAERAMDIYRTFTKQTDAVV
QYLSVARLHEHHTRVEVPKLKHAPVNLGRQLEEYLKDPDFEIHRRQYIAEQEAKKKGTRTTPSKTAKAEDFPSPS
TFAIARKPQNKGPDPDLIDFFDSIEQNQTPMQTDPQQVNAVAFQPQQTGMPLASNGFTTQLTGFAGSDPFQQQQQ
QQQQQQQQLFAQPQQLQVSYTGASFGSYTSQPQSGFQPGALGSIPQESVASFQNQPTGMQPMQTGTNPFRQSMLM
AQQTGIQRPFSPPTTGTPFINRQSTNPFARSPPPASSPFQSQPPVAAPLQPTLTGTNPFARASFQQPQDPMQTGM
VPQATGSNPFRTSSVTGHATGMAWQHNQAPIGGGIDQLSTVPVFPRPAQQTPWQQ*
Coding >Ophcf2|02587
ATGTCCAGCTCGTTCGAAAAGTCCGTCAAGGGCGCCACCAAGATCAAGAATGCGCCGCCAAAGAACAAGTACATC
GAGCACATCCTCGTCGCCACCCACGCCGGCGAGGCCGGCACCGGTGAAGTCTTTCGCGCCCTGCAGCATCGTCTT
CGCGACTCGACCTGGACCGTCGTTCTCAAGAGCCTGATCGTCATTCATCTCATGATCCGCGAGGGTTCTCCCGAT
GTCGCCCTGTCCTATCTCGCTCGGAACCGCAATATCTTGGCCTTGGGCCACTTCTCCGATGCTCAGACACAGGGC
AGAAACATTCGCCACTATGCCAGCTACCTGTTCGAGCGCGCCAAGGCCTATCGTGATACCAAGACCGACTGGGTC
CGCGCCCCGGAATCAAGGCTCGAGAGGCTGTCTGTAGACAAGGGCTTGCTGCGCGAGACGGAAGTGGTCCAGACC
CAGCTCCAGGCTCTGGTCAATTGTGACGTCTTGGAGTCGGAGCCGCAAAACGACATTACTGTTCTCGTTTTTCGA
CTTCTTGTCCTCGACCTGTTGGCCCTATTTCAGATGCTCAACCAGGGACTCATCAATATCCTGGGCCACTTCTTT
GAAATGTCCAAGCCCGATGCGGAGAGGGCTATGGACATCTACCGCACCTTTACCAAGCAGACGGACGCTGTCGTT
CAATATCTCAGTGTTGCCAGGTTGCACGAGCATCACACGCGCGTCGAAGTGCCCAAACTCAAGCACGCCCCCGTG
AACCTGGGTCGCCAACTCGAGGAATACCTCAAGGACCCCGACTTTGAAATTCATCGGCGGCAGTACATTGCCGAG
CAGGAGGCCAAGAAGAAAGGGACCAGGACTACGCCTTCCAAGACGGCCAAGGCGGAGGACTTTCCGAGCCCGTCC
ACCTTTGCTATTGCGAGAAAGCCGCAGAACAAGGGTCCGGATCCTGATCTCATCGACTTCTTCGACTCGATCGAA
CAGAACCAGACGCCAATGCAGACTGACCCACAGCAGGTTAATGCGGTTGCCTTTCAGCCTCAGCAGACGGGCATG
CCACTTGCGTCCAATGGCTTTACCACTCAGCTCACCGGCTTTGCAGGCAGCGACCCCTTTCAACAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAATTGTTCGCCCAGCCGCAACAGCTGCAGGTCAGCTACACGGGAGCTAGCTTC
GGTAGCTACACGTCACAGCCACAGTCGGGCTTCCAGCCGGGTGCTCTCGGGTCCATCCCGCAAGAAAGCGTGGCC
AGCTTTCAGAACCAGCCAACGGGGATGCAGCCGATGCAGACGGGCACAAATCCCTTTCGGCAGTCCATGCTGATG
GCCCAGCAGACAGGGATTCAGCGCCCATTCTCGCCGCCCACGACGGGCACCCCATTCATTAACCGCCAGTCGACG
AACCCGTTCGCCCGCTCGCCGCCTCCTGCTTCGTCACCTTTCCAGTCGCAGCCGCCAGTAGCAGCGCCTCTGCAG
CCCACTCTCACGGGCACCAATCCCTTCGCTCGCGCCTCTTTCCAGCAGCCGCAGGATCCGATGCAGACAGGCATG
GTGCCACAGGCTACGGGCTCGAACCCTTTCCGAACCAGCTCCGTAACCGGCCATGCGACGGGCATGGCGTGGCAG
CACAACCAGGCGCCCATCGGCGGGGGCATAGATCAACTGTCGACGGTCCCGGTCTTTCCGCGGCCGGCGCAACAA
ACTCCATGGCAGCAGTGA
Transcript >Ophcf2|02587
ATGTCCAGCTCGTTCGAAAAGTCCGTCAAGGGCGCCACCAAGATCAAGAATGCGCCGCCAAAGAACAAGTACATC
GAGCACATCCTCGTCGCCACCCACGCCGGCGAGGCCGGCACCGGTGAAGTCTTTCGCGCCCTGCAGCATCGTCTT
CGCGACTCGACCTGGACCGTCGTTCTCAAGAGCCTGATCGTCATTCATCTCATGATCCGCGAGGGTTCTCCCGAT
GTCGCCCTGTCCTATCTCGCTCGGAACCGCAATATCTTGGCCTTGGGCCACTTCTCCGATGCTCAGACACAGGGC
AGAAACATTCGCCACTATGCCAGCTACCTGTTCGAGCGCGCCAAGGCCTATCGTGATACCAAGACCGACTGGGTC
CGCGCCCCGGAATCAAGGCTCGAGAGGCTGTCTGTAGACAAGGGCTTGCTGCGCGAGACGGAAGTGGTCCAGACC
CAGCTCCAGGCTCTGGTCAATTGTGACGTCTTGGAGTCGGAGCCGCAAAACGACATTACTGTTCTCGTTTTTCGA
CTTCTTGTCCTCGACCTGTTGGCCCTATTTCAGATGCTCAACCAGGGACTCATCAATATCCTGGGCCACTTCTTT
GAAATGTCCAAGCCCGATGCGGAGAGGGCTATGGACATCTACCGCACCTTTACCAAGCAGACGGACGCTGTCGTT
CAATATCTCAGTGTTGCCAGGTTGCACGAGCATCACACGCGCGTCGAAGTGCCCAAACTCAAGCACGCCCCCGTG
AACCTGGGTCGCCAACTCGAGGAATACCTCAAGGACCCCGACTTTGAAATTCATCGGCGGCAGTACATTGCCGAG
CAGGAGGCCAAGAAGAAAGGGACCAGGACTACGCCTTCCAAGACGGCCAAGGCGGAGGACTTTCCGAGCCCGTCC
ACCTTTGCTATTGCGAGAAAGCCGCAGAACAAGGGTCCGGATCCTGATCTCATCGACTTCTTCGACTCGATCGAA
CAGAACCAGACGCCAATGCAGACTGACCCACAGCAGGTTAATGCGGTTGCCTTTCAGCCTCAGCAGACGGGCATG
CCACTTGCGTCCAATGGCTTTACCACTCAGCTCACCGGCTTTGCAGGCAGCGACCCCTTTCAACAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAATTGTTCGCCCAGCCGCAACAGCTGCAGGTCAGCTACACGGGAGCTAGCTTC
GGTAGCTACACGTCACAGCCACAGTCGGGCTTCCAGCCGGGTGCTCTCGGGTCCATCCCGCAAGAAAGCGTGGCC
AGCTTTCAGAACCAGCCAACGGGGATGCAGCCGATGCAGACGGGCACAAATCCCTTTCGGCAGTCCATGCTGATG
GCCCAGCAGACAGGGATTCAGCGCCCATTCTCGCCGCCCACGACGGGCACCCCATTCATTAACCGCCAGTCGACG
AACCCGTTCGCCCGCTCGCCGCCTCCTGCTTCGTCACCTTTCCAGTCGCAGCCGCCAGTAGCAGCGCCTCTGCAG
CCCACTCTCACGGGCACCAATCCCTTCGCTCGCGCCTCTTTCCAGCAGCCGCAGGATCCGATGCAGACAGGCATG
GTGCCACAGGCTACGGGCTCGAACCCTTTCCGAACCAGCTCCGTAACCGGCCATGCGACGGGCATGGCGTGGCAG
CACAACCAGGCGCCCATCGGCGGGGGCATAGATCAACTGTCGACGGTCCCGGTCTTTCCGCGGCCGGCGCAACAA
ACTCCATGGCAGCAGTGA
Gene >Ophcf2|02587
ATGTCCAGCTCGTTCGAAAAGTCCGTCAAGGGCGCCACCAAGATCAAGGTAGCCCAGCTCCGCTTCTCGGCTTCC
TCGCCTCGCTGAACCCTTCTCGCAGAATGCGCCGCCAAAGAACAAGTACATCGAGCACATCCTCGTCGCCACCCA
CGCCGGCGAGGCCGGCACCGGTGAAGTCTTTCGCGCCCTGCAGCATCGTCTTCGCGACTCGACCTGGACCGTCGT
TCTCAAGAGCCTGATCGTCATTCATCTCATGATCCGCGAGGGTTCTCCCGATGTCGCCCTGTCCTATCTCGCTCG
GAACCGCAATATCTTGGCCTTGGGCCACTTCTCCGATGGTCCGATTCGCTCTCGTCACCGTGACCTGGACGACGC
TGACCGACTTACAGCTCAGACACAGGGCAGAAACATTCGCCACTATGCCAGCTACCTGTTCGAGCGCGCCAAGGC
CTATCGTGATACCAAGACCGACTGGGTCCGCGCCCCGGAATCAAGGCTCGAGAGGCTGTCTGTAGACAAGGGCTT
GCTGCGCGAGACGGAAGTGGTCCAGACCCAGCTCCAGGCTCTGGTCAATTGTGACGTGAGTTCAGCCACTCGCCC
CGGCCCCCTACCCCGTCGCTGACTGACGACATGTTCTACAGGTCTTGGAGTCGGAGCCGCAAAACGACATTACTG
TTCTCGTTTTTCGACTTCTTGTCCTCGACCTGTTGGCCCTATTTCAGATGCTCAACCAGGGACTCATCAATATCC
TGGGTGAGCTGCTCGCACGCCCTCTCTCCATCCCCTCTCTCTTATCAAACTGAGACGAGCTTCAGGCCACTTCTT
TGAAATGTCCAAGCCCGATGCGGAGAGGGCTATGGACATCTACCGCACCTTTACCAAGCAGACGGACGCTGTCGT
TCAATATCTCAGTGTTGCCAGGTTGCACGAGCATCACACGCGCGTCGAAGTGCCCAAACTCAAGCACGCCCCCGT
GAACCTGGGTCGCCAACTCGAGGAATACCTCAAGGACCCCGACTTTGAAATTCATCGGCGGCAGTACATTGCCGA
GCAGGAGGCCAAGAAGAAAGGGACCAGGACTACGCCTTCCAAGACGGCCAAGGCGGAGGACTTTCCGAGCCCGTC
CACCTTTGCTATTGCGAGAAAGCCGCAGAACAAGGGTCCGGATCCTGATCTCATCGACTTCTTCGACTCGATCGA
ACAGAACCAGACGCCAATGCAGACTGACCCACAGCAGGTTAATGCGGTTGCCTTTCAGCCTCAGCAGACGGGCAT
GCCACTTGCGTCCAATGGCTTTACCACTCAGCTCACCGGCTTTGCAGGCAGCGACCCCTTTCAACAGCAGCAGCA
GCAGCAGCAGCAGCAGCAGCAGCAATTGTTCGCCCAGCCGCAACAGCTGCAGGTCAGCTACACGGGAGCTAGCTT
CGGTAGCTACACGTCACAGCCACAGTCGGGCTTCCAGCCGGGTGCTCTCGGGTCCATCCCGCAAGAAAGCGTGGC
CAGCTTTCAGAACCAGCCAACGGGGATGCAGCCGATGCAGACGGGCACAAATCCCTTTCGGCAGTCCATGCTGAT
GGCCCAGCAGACAGGGATTCAGCGCCCATTCTCGCCGCCCACGACGGGCACCCCATTCATTAACCGCCAGTCGAC
GAACCCGTTCGCCCGCTCGCCGCCTCCTGCTTCGTCACCTTTCCAGTCGCAGCCGCCAGTAGCAGCGCCTCTGCA
GCCCACTCTCACGGGCACCAATCCCTTCGCTCGCGCCTCTTTCCAGCAGCCGCAGGATCCGATGCAGACAGGCAT
GGTGCCACAGGCTACGGGCTCGAACCCTTTCCGAACCAGCTCCGTAACCGGCCATGCGACGGGCATGGCGTGGCA
GCACAACCAGGCGCCCATCGGCGGGGGCATAGATCAACTGTCGACGGTCCCGGTCTTTCCGCGGCCGGCGCAACA
AACTCCATGGCAGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail