Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02584
Gene name
Locationscaffold_02:4138599..4138974
Strand+
Gene length (bp)375
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.4E-10 24 66
PF01476 LysM LysM domain 3.7E-08 77 123

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1731 0.0708 0.942 0.0563 0.0847 0.0256 0.174 0.1797 0.1005 0.0024

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999354

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup229
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4895
Ophiocordyceps camponoti-floridani Ophcf2|01392
Ophiocordyceps camponoti-floridani Ophcf2|02584 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03908
Ophiocordyceps camponoti-rufipedis Ophun1|4148
Ophiocordyceps camponoti-rufipedis Ophun1|6485
Ophiocordyceps kimflemingae Ophio5|2669
Ophiocordyceps kimflemingae Ophio5|5651
Ophiocordyceps kimflemingae Ophio5|5719
Ophiocordyceps subramaniannii Hirsu2|3699
Ophiocordyceps subramaniannii Hirsu2|6751

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02584
MALLRIMFIAGALCSAASACAENYTVTLGDSCWGIAVSKSVSMKNLQAWNTNVNCGRLHPGDEMCVSQRNVPCKY
HHHVVQGDSCYKIAQKEETTVQHLFEMNPNLINSPYDCPLFPGQKVCVV*
Coding >Ophcf2|02584
ATGGCCCTCCTCCGGATCATGTTCATCGCCGGAGCTCTCTGCTCTGCCGCCTCGGCCTGCGCAGAGAACTATACC
GTCACCTTGGGCGACAGCTGCTGGGGAATCGCGGTGAGCAAGTCTGTCTCCATGAAGAATCTCCAGGCTTGGAAC
ACGAATGTCAACTGCGGCCGGCTTCATCCCGGAGATGAGATGTGCGTCTCCCAGCGCAACGTTCCTTGCAAATAT
CACCACCATGTCGTCCAAGGCGATTCCTGCTACAAGATCGCACAAAAAGAGGAGACTACAGTTCAGCATTTATTC
GAAATGAACCCGAACCTGATCAACAGCCCGTACGACTGCCCGCTGTTCCCGGGCCAGAAGGTCTGCGTGGTCTAG
Transcript >Ophcf2|02584
ATGGCCCTCCTCCGGATCATGTTCATCGCCGGAGCTCTCTGCTCTGCCGCCTCGGCCTGCGCAGAGAACTATACC
GTCACCTTGGGCGACAGCTGCTGGGGAATCGCGGTGAGCAAGTCTGTCTCCATGAAGAATCTCCAGGCTTGGAAC
ACGAATGTCAACTGCGGCCGGCTTCATCCCGGAGATGAGATGTGCGTCTCCCAGCGCAACGTTCCTTGCAAATAT
CACCACCATGTCGTCCAAGGCGATTCCTGCTACAAGATCGCACAAAAAGAGGAGACTACAGTTCAGCATTTATTC
GAAATGAACCCGAACCTGATCAACAGCCCGTACGACTGCCCGCTGTTCCCGGGCCAGAAGGTCTGCGTGGTCTAG
Gene >Ophcf2|02584
ATGGCCCTCCTCCGGATCATGTTCATCGCCGGAGCTCTCTGCTCTGCCGCCTCGGCCTGCGCAGAGAACTATACC
GTCACCTTGGGCGACAGCTGCTGGGGAATCGCGGTGAGCAAGTCTGTCTCCATGAAGAATCTCCAGGCTTGGAAC
ACGAATGTCAACTGCGGCCGGCTTCATCCCGGAGATGAGATGTGCGTCTCCCAGCGCAACGTTCCTTGCAAATAT
CACCACCATGTCGTCCAAGGCGATTCCTGCTACAAGATCGCACAAAAAGAGGAGACTACAGTTCAGCATTTATTC
GAAATGAACCCGAACCTGATCAACAGCCCGTACGACTGCCCGCTGTTCCCGGGCCAGAAGGTCTGCGTGGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail