Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02579
Gene name
Locationscaffold_02:4131083..4131604
Strand+
Gene length (bp)521
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08583 Cmc1 Cytochrome c oxidase biogenesis protein Cmc1 like 2.7E-18 34 101

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.3281 0.1588 0.0916 0.0405 0.8849 0.0053 0.2244 0.1113 0.3401 0.2955

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 99.41 47.81 151.02
Alive In ants, during behavior modification 51.49 20.16 82.82
Dead In ants, recently dead 53.28 22.10 84.46

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.004680 yes
Alive Dead 0.908514 no
Dead Fungus 0.006475 yes

Orthologs

Orthofinder run ID4
Orthogroup295
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4587
Ophiocordyceps australis 1348a (Ghana) OphauG2|4589
Ophiocordyceps australis map64 (Brazil) OphauB2|348
Ophiocordyceps australis map64 (Brazil) OphauB2|353
Ophiocordyceps camponoti-floridani Ophcf2|02578
Ophiocordyceps camponoti-floridani Ophcf2|02579 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4143
Ophiocordyceps kimflemingae Ophio5|2663
Ophiocordyceps kimflemingae Ophio5|2664
Ophiocordyceps subramaniannii Hirsu2|9491
Ophiocordyceps subramaniannii Hirsu2|9492

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02579
MAAQASGTPDDGGQRPRLVATSPLPLSASQEAQVRELYRTRVRQKCADEIKAFAACATGRTFSVVFACRDQHRAM
NSCMNSYATRQEEDAAREEWFALRLQRTRRREHEARVAAAQEDFMHDWWGLPDDVRLSKKGRQQADKTVKDQGGG
TAS*
Coding >Ophcf2|02579
ATGGCGGCTCAGGCGTCGGGCACCCCAGATGATGGCGGCCAGCGTCCTCGCCTCGTAGCAACAAGCCCGCTACCG
CTCTCGGCCTCACAGGAAGCTCAAGTGCGCGAGCTATACCGAACGCGCGTGCGGCAAAAATGCGCCGATGAGATC
AAAGCATTCGCGGCGTGCGCCACCGGGCGGACCTTTTCCGTCGTCTTCGCCTGCCGCGACCAGCATCGGGCCATG
AACAGCTGCATGAACAGCTACGCGACGCGCCAGGAGGAGGACGCGGCTCGTGAGGAGTGGTTCGCTTTGCGGCTG
CAGCGGACGAGGCGGCGGGAACACGAGGCTCGCGTTGCGGCTGCGCAGGAAGACTTCATGCATGACTGGTGGGGG
CTGCCGGACGACGTGAGGCTCTCCAAGAAGGGGCGGCAGCAGGCGGATAAGACGGTTAAGGACCAAGGAGGCGGG
ACGGCGAGCTGA
Transcript >Ophcf2|02579
ATGGCGGCTCAGGCGTCGGGCACCCCAGATGATGGCGGCCAGCGTCCTCGCCTCGTAGCAACAAGCCCGCTACCG
CTCTCGGCCTCACAGGAAGCTCAAGTGCGCGAGCTATACCGAACGCGCGTGCGGCAAAAATGCGCCGATGAGATC
AAAGCATTCGCGGCGTGCGCCACCGGGCGGACCTTTTCCGTCGTCTTCGCCTGCCGCGACCAGCATCGGGCCATG
AACAGCTGCATGAACAGCTACGCGACGCGCCAGGAGGAGGACGCGGCTCGTGAGGAGTGGTTCGCTTTGCGGCTG
CAGCGGACGAGGCGGCGGGAACACGAGGCTCGCGTTGCGGCTGCGCAGGAAGACTTCATGCATGACTGGTGGGGG
CTGCCGGACGACGTGAGGCTCTCCAAGAAGGGGCGGCAGCAGGCGGATAAGACGGTTAAGGACCAAGGAGGCGGG
ACGGCGAGCTGA
Gene >Ophcf2|02579
ATGGCGGCTCAGGCGTCGGGCACCCCAGATGATGGCGGCCAGCGTCCTCGCCTCGTAGCAACAAGCCCGCTACCG
CTCTCGGCCTCACAGGAAGCTCAAGTGCGCGAGCTATACCGAACGCGCGTGCGGCAAAAATGCGCCGATGAGATC
AAAGGTCCGTCTCGGACCTTCTCCCATGGAGCACAGCTGCAGTTCTCTAACAGACGACGACAGCATTCGCGGCGT
GCGCCACCGGGCGGACCTTTTCCGTCGTCTTCGCCTGCCGCGACCAGCATCGGGCCATGAACAGCTGCATGAACA
GCTACGCGACGCGCCAGGAGGAGGACGCGGCTCGTGAGGAGTGGTTCGCTTTGCGGCTGCAGCGGACGAGGCGGC
GGGAACACGAGGCTCGCGTTGCGGCTGCGCAGGAAGACTTCATGCATGACTGGTGGGGGCTGCCGGACGACGTGA
GGCTCTCCAAGAAGGGGCGGCAGCAGGCGGATAAGACGGTTAAGGACCAAGGAGGCGGGACGGCGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail