Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02576
Gene name
Locationscaffold_02:4126071..4126837
Strand-
Gene length (bp)766
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00578 AhpC-TSA AhpC/TSA family 2.1E-35 6 139
PF08534 Redoxin Redoxin 4.8E-13 8 150
PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin 1.5E-11 160 193

GO

GO Term Description Terminal node
GO:0016209 antioxidant activity Yes
GO:0051920 peroxiredoxin activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.818 0.34 0.2099 0.2024 0.3317 0.0152 0.0895 0.0819 0.1101 0.1743

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6315
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02576 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4141
Ophiocordyceps kimflemingae Ophio5|2661
Ophiocordyceps subramaniannii Hirsu2|9495

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02576
MSSASVQQPAPLFTSQAVEAGEIKDVSLSDYVGQWVVLLFYPLDFTFVCPTEIIEFNDALPKFRELNTKVLALST
DSHFSHLAWTKCPRAKGGLGEDLQLPLVADKSLRISRSYGVLLEKEGIALRGLFIIDPKGVLRVININDLPVGRS
VTETIRLVEAFQFVEEHGEACPAGWNKGAKTIKADPKGSLEYFAAAHGENGNAQGNGSAH*
Coding >Ophcf2|02576
ATGTCCTCCGCCTCCGTGCAGCAGCCCGCACCCCTCTTCACCTCGCAGGCTGTCGAGGCGGGCGAGATCAAGGAC
GTCTCCTTGTCCGACTATGTCGGGCAGTGGGTTGTCCTCCTCTTCTACCCGCTGGACTTTACCTTTGTCTGCCCT
ACCGAGATCATCGAGTTCAACGACGCGCTCCCCAAGTTCCGCGAGCTGAATACCAAGGTGTTGGCCCTCTCGACC
GATTCTCACTTCAGCCACCTCGCCTGGACCAAATGCCCGCGGGCCAAGGGCGGTCTCGGTGAAGACCTGCAGCTC
CCCCTCGTGGCGGACAAGTCTCTGCGCATCTCTAGGAGCTATGGTGTGCTGCTGGAGAAGGAGGGAATCGCCCTC
CGCGGCCTCTTCATCATTGATCCCAAGGGCGTTCTGAGGGTCATCAACATCAACGACCTGCCCGTAGGTCGCAGC
GTCACCGAGACCATCCGTCTGGTCGAGGCCTTCCAGTTCGTTGAGGAGCATGGAGAGGCCTGCCCGGCTGGCTGG
AACAAGGGGGCCAAGACGATCAAGGCCGATCCCAAGGGTAGCCTCGAATACTTTGCCGCCGCCCATGGCGAGAAC
GGCAATGCCCAGGGCAATGGCTCTGCCCATTGA
Transcript >Ophcf2|02576
ATGTCCTCCGCCTCCGTGCAGCAGCCCGCACCCCTCTTCACCTCGCAGGCTGTCGAGGCGGGCGAGATCAAGGAC
GTCTCCTTGTCCGACTATGTCGGGCAGTGGGTTGTCCTCCTCTTCTACCCGCTGGACTTTACCTTTGTCTGCCCT
ACCGAGATCATCGAGTTCAACGACGCGCTCCCCAAGTTCCGCGAGCTGAATACCAAGGTGTTGGCCCTCTCGACC
GATTCTCACTTCAGCCACCTCGCCTGGACCAAATGCCCGCGGGCCAAGGGCGGTCTCGGTGAAGACCTGCAGCTC
CCCCTCGTGGCGGACAAGTCTCTGCGCATCTCTAGGAGCTATGGTGTGCTGCTGGAGAAGGAGGGAATCGCCCTC
CGCGGCCTCTTCATCATTGATCCCAAGGGCGTTCTGAGGGTCATCAACATCAACGACCTGCCCGTAGGTCGCAGC
GTCACCGAGACCATCCGTCTGGTCGAGGCCTTCCAGTTCGTTGAGGAGCATGGAGAGGCCTGCCCGGCTGGCTGG
AACAAGGGGGCCAAGACGATCAAGGCCGATCCCAAGGGTAGCCTCGAATACTTTGCCGCCGCCCATGGCGAGAAC
GGCAATGCCCAGGGCAATGGCTCTGCCCATTGA
Gene >Ophcf2|02576
ATGTCCTCCGCCTCCGTGCAGCAGCCCGCACCCCTCTTCACCTCGCAGGCTGTCGAGGCGGGCGAGATCAAGGAC
GTCTCCTTGTCCGACTATGTCGGGCAGTGGTAAGTTGAAGGGAGTCGGATGGAGCTTCCAAGCTCACATGGCCCA
GGGTTGTCCTCCTCTTCTACCCGCTGGACTTTACCTTTGTCTGCCCTACCGAGATCATCGAGTTCAACGACGCGC
TCCCCAAGTTCCGCGAGCTGAATACCAAGGTGTTGGCCCTCTCGACCGATTCTCACTTCAGCCACCTCGCCTGGA
CCAAATGCCCGCGGGCCAAGGGCGGTCTCGGTGAAGACCTGCAGCTCCCCCTCGTGGCGGACAAGTCTCTGCGCA
TCTCTAGGAGCTATGGTGTGCTGCTGGAGAAGGAGGGAATCGCCCTCCGCGGCCTCTTCATCATTGATCCCAAGG
GCGTTCTGAGGGTCATCAACATCAACGACCTGCCCGTAGGTCGCAGCGTCACCGAGACCATCCGTCTGGTCGAGG
CCTTCCAGTTCGTTGAGGAGCATGGAGAGGCCTGCCCGGCTGGCTGGAACAAGGGGGCCAAGACGATCAAGGCCG
ATCCCAAGGGTAGCCTCGAATACTTTGCCGCCGCCCATGGCGAGAACGGCAATGCCCAGGGCAATGGTGAGTCAA
ACAAGCGGCCGCGGCTGGAGTAGGGCCTGTCAGCCCATGCAAGGGCGCGGGGGTGGGCTTGCTTACACGTCGACT
AGGCTCTGCCCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail