Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02570
Gene name
Locationscaffold_02:4110585..4111638
Strand-
Gene length (bp)1053
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1826 0.0719 0.9052 0.0697 0.1768 0.0122 0.4142 0.3159 0.1269 0.0146

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999763

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6084
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02570 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4135
Ophiocordyceps kimflemingae Ophio5|1003
Ophiocordyceps subramaniannii Hirsu2|2980
Ophiocordyceps subramaniannii Hirsu2|5589

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02570
MLRLLSLLAWILSTAVNGQRAPPPYRQQDDSRPPSGLPTRIVQQFPPSIWIENMAVRSNGNLILNQLRPSAAVIQ
VTDPSSPYSYYEVAAIFPSIDGLYGITEVSEDVFVVVGCRFATIGDNVKGSAETWMVNFKSTDRSGGPLVKRVGR
HPYMEFPNGITSLPGVDDVVLIADSTLGLVWRLYLETGVTEVAVQVREMAYRQGTRLKIGINGIKINDGYLWWSN
SYVGELYRLRIDRLGNPERNARPELMYRHRGRFIDDFALDDRGVWGTTNQNNTVLFAAYGGRVSDVAGKQTGLEL
AVDTSCAFGRGARDGEILYVATGNDAKRGLGGKVVAVDTTSVRPRGNYFN*
Coding >Ophcf2|02570
ATGCTACGACTCCTTTCTCTTCTCGCCTGGATCCTATCCACAGCTGTCAACGGCCAGCGCGCGCCGCCCCCCTAC
CGCCAACAAGACGACAGCCGTCCTCCTTCGGGCCTACCGACGCGGATCGTGCAGCAATTTCCGCCTTCAATATGG
ATAGAGAACATGGCGGTTCGCAGTAACGGGAACCTGATCCTCAACCAGCTGCGTCCCAGCGCAGCCGTCATACAG
GTGACGGATCCGTCCAGCCCGTACTCGTACTATGAAGTCGCCGCCATCTTCCCTTCCATCGACGGCTTATACGGT
ATTACCGAAGTGTCGGAGGATGTGTTTGTCGTTGTGGGCTGTCGGTTCGCTACCATTGGTGATAACGTCAAGGGC
TCGGCCGAGACGTGGATGGTCAACTTTAAGAGCACGGATCGTAGCGGAGGTCCCCTGGTCAAGAGGGTAGGCAGA
CATCCGTACATGGAGTTCCCCAACGGCATAACGTCACTTCCTGGCGTCGATGACGTCGTCCTCATCGCCGACTCG
ACCCTCGGCCTGGTCTGGCGACTGTATCTGGAGACGGGCGTGACCGAGGTAGCGGTTCAAGTGCGAGAGATGGCT
TACCGCCAGGGAACGAGGCTCAAGATCGGAATCAACGGCATCAAAATCAACGACGGCTACCTATGGTGGTCCAAC
AGTTACGTAGGCGAGCTATACCGCCTCCGAATCGACCGACTCGGCAACCCGGAGCGCAACGCCCGACCCGAACTC
ATGTACCGTCACCGGGGCCGCTTCATCGACGACTTCGCCTTGGACGACCGCGGCGTATGGGGCACCACCAACCAG
AATAACACGGTCCTGTTCGCTGCGTACGGCGGGCGAGTTTCCGACGTGGCCGGCAAGCAAACCGGCCTCGAACTC
GCCGTCGACACCTCGTGCGCCTTCGGAAGAGGCGCGAGGGACGGGGAGATACTGTACGTTGCGACGGGGAATGAT
GCGAAAAGAGGCCTGGGCGGGAAAGTCGTGGCTGTTGATACAACTTCCGTCAGACCACGGGGGAACTACTTCAAC
TGA
Transcript >Ophcf2|02570
ATGCTACGACTCCTTTCTCTTCTCGCCTGGATCCTATCCACAGCTGTCAACGGCCAGCGCGCGCCGCCCCCCTAC
CGCCAACAAGACGACAGCCGTCCTCCTTCGGGCCTACCGACGCGGATCGTGCAGCAATTTCCGCCTTCAATATGG
ATAGAGAACATGGCGGTTCGCAGTAACGGGAACCTGATCCTCAACCAGCTGCGTCCCAGCGCAGCCGTCATACAG
GTGACGGATCCGTCCAGCCCGTACTCGTACTATGAAGTCGCCGCCATCTTCCCTTCCATCGACGGCTTATACGGT
ATTACCGAAGTGTCGGAGGATGTGTTTGTCGTTGTGGGCTGTCGGTTCGCTACCATTGGTGATAACGTCAAGGGC
TCGGCCGAGACGTGGATGGTCAACTTTAAGAGCACGGATCGTAGCGGAGGTCCCCTGGTCAAGAGGGTAGGCAGA
CATCCGTACATGGAGTTCCCCAACGGCATAACGTCACTTCCTGGCGTCGATGACGTCGTCCTCATCGCCGACTCG
ACCCTCGGCCTGGTCTGGCGACTGTATCTGGAGACGGGCGTGACCGAGGTAGCGGTTCAAGTGCGAGAGATGGCT
TACCGCCAGGGAACGAGGCTCAAGATCGGAATCAACGGCATCAAAATCAACGACGGCTACCTATGGTGGTCCAAC
AGTTACGTAGGCGAGCTATACCGCCTCCGAATCGACCGACTCGGCAACCCGGAGCGCAACGCCCGACCCGAACTC
ATGTACCGTCACCGGGGCCGCTTCATCGACGACTTCGCCTTGGACGACCGCGGCGTATGGGGCACCACCAACCAG
AATAACACGGTCCTGTTCGCTGCGTACGGCGGGCGAGTTTCCGACGTGGCCGGCAAGCAAACCGGCCTCGAACTC
GCCGTCGACACCTCGTGCGCCTTCGGAAGAGGCGCGAGGGACGGGGAGATACTGTACGTTGCGACGGGGAATGAT
GCGAAAAGAGGCCTGGGCGGGAAAGTCGTGGCTGTTGATACAACTTCCGTCAGACCACGGGGGAACTACTTCAAC
TGA
Gene >Ophcf2|02570
ATGCTACGACTCCTTTCTCTTCTCGCCTGGATCCTATCCACAGCTGTCAACGGCCAGCGCGCGCCGCCCCCCTAC
CGCCAACAAGACGACAGCCGTCCTCCTTCGGGCCTACCGACGCGGATCGTGCAGCAATTTCCGCCTTCAATATGG
ATAGAGAACATGGCGGTTCGCAGTAACGGGAACCTGATCCTCAACCAGCTGCGTCCCAGCGCAGCCGTCATACAG
GTGACGGATCCGTCCAGCCCGTACTCGTACTATGAAGTCGCCGCCATCTTCCCTTCCATCGACGGCTTATACGGT
ATTACCGAAGTGTCGGAGGATGTGTTTGTCGTTGTGGGCTGTCGGTTCGCTACCATTGGTGATAACGTCAAGGGC
TCGGCCGAGACGTGGATGGTCAACTTTAAGAGCACGGATCGTAGCGGAGGTCCCCTGGTCAAGAGGGTAGGCAGA
CATCCGTACATGGAGTTCCCCAACGGCATAACGTCACTTCCTGGCGTCGATGACGTCGTCCTCATCGCCGACTCG
ACCCTCGGCCTGGTCTGGCGACTGTATCTGGAGACGGGCGTGACCGAGGTAGCGGTTCAAGTGCGAGAGATGGCT
TACCGCCAGGGAACGAGGCTCAAGATCGGAATCAACGGCATCAAAATCAACGACGGCTACCTATGGTGGTCCAAC
AGTTACGTAGGCGAGCTATACCGCCTCCGAATCGACCGACTCGGCAACCCGGAGCGCAACGCCCGACCCGAACTC
ATGTACCGTCACCGGGGCCGCTTCATCGACGACTTCGCCTTGGACGACCGCGGCGTATGGGGCACCACCAACCAG
AATAACACGGTCCTGTTCGCTGCGTACGGCGGGCGAGTTTCCGACGTGGCCGGCAAGCAAACCGGCCTCGAACTC
GCCGTCGACACCTCGTGCGCCTTCGGAAGAGGCGCGAGGGACGGGGAGATACTGTACGTTGCGACGGGGAATGAT
GCGAAAAGAGGCCTGGGCGGGAAAGTCGTGGCTGTTGATACAACTTCCGTCAGACCACGGGGGAACTACTTCAAC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail