Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02567
Gene name
Locationscaffold_02:4104133..4105937
Strand+
Gene length (bp)1804
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03441 FAD_binding_7 FAD binding domain of DNA photolyase 6.9E-81 376 571
PF00875 DNA_photolyase DNA photolyase 1.4E-34 86 247

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4049 0.8769 0.0728 0.0096 0.2894 0.0197 0.0554 0.045 0.071 0.0063

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4515
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6692
Ophiocordyceps australis map64 (Brazil) OphauB2|62
Ophiocordyceps camponoti-floridani Ophcf2|02567 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4132
Ophiocordyceps kimflemingae Ophio5|1000
Ophiocordyceps subramaniannii Hirsu2|9434

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02567
MKYSLTAEGTGGKRLKKESDLRGPHPLAKDSAQQGIVLRKFYPPEMTNRRALAYAEGEIIRPINELICVLDDTEK
KREAVKVGRSVVHWFKTDLRHKDNRALAMASDKAKSAGVPLICIYLVSPQDFEAHLMAPIRVDFVLRTLDVLRRD
LARLDIPLFVETVDKRKKLPGRIMELMEEWGSNHLFANMEYEVDELRREARLVRELSQVGKSFDVVHDTCVVKPG
NIRASTGRQFSVYSHWFRNWHRLIYSHPDWLELSDPPAKNPDSARKRFKKLFDCPIPEAPESKRLSADDKERFSA
LWPCGEHAAAERLAKFCQEKIGQYHEKRNIPADDGTSSMSVHLASGTISSRTCVRTARDHNTTKKLDGGNEGIMS
WISEVAWREFYKHVLVAWPYVCMNKPFKLRFTSIEWSYDEDHFAAWCEGRTGFPIVDAAMRQLNSIGYMHNRCRM
IVASFLAKDLLIDWRKGERYFMEHLVDGDFASNSGGWGFSASVGVDPQPYFRIFNPLLQSEKFDPSGEYIRKWIP
ELKDLDNKQIHDPYGRGGAVQAKKSGYPKPIVNHSQMRLQTLEKYRIAPGDTSCLKE*
Coding >Ophcf2|02567
ATGAAATATTCTCTGACCGCAGAGGGCACGGGAGGGAAACGACTCAAGAAGGAGAGCGACTTGCGTGGGCCTCAT
CCGTTGGCGAAAGACTCCGCGCAGCAGGGCATCGTGCTTCGAAAATTCTACCCCCCGGAGATGACCAACCGCCGA
GCTCTGGCTTACGCTGAAGGTGAAATCATACGTCCCATCAACGAGCTCATCTGCGTTCTCGACGACACGGAGAAG
AAGCGCGAGGCCGTCAAAGTTGGTCGTTCCGTTGTCCATTGGTTCAAGACGGACCTCCGCCACAAAGACAACAGG
GCCCTTGCCATGGCCAGCGACAAGGCCAAGTCGGCCGGCGTACCGCTCATCTGCATCTATCTCGTCAGCCCTCAA
GACTTTGAGGCCCACCTCATGGCGCCTATCCGGGTCGACTTTGTGCTGAGGACACTTGATGTGTTGCGTCGTGAC
CTGGCGCGTCTCGACATCCCGCTCTTTGTTGAGACGGTCGACAAGAGGAAAAAGCTGCCCGGTCGCATCATGGAA
CTCATGGAGGAATGGGGCAGCAATCACCTTTTTGCCAACATGGAGTACGAGGTCGACGAGCTGCGACGAGAGGCG
CGTTTAGTCCGCGAACTCTCCCAGGTCGGCAAGTCCTTTGATGTCGTCCACGACACCTGCGTCGTCAAACCGGGG
AATATCAGGGCCAGCACCGGGAGGCAGTTTTCCGTCTATAGTCATTGGTTTCGCAACTGGCACAGACTCATCTAC
TCCCATCCGGATTGGCTCGAGCTCTCCGATCCGCCAGCCAAGAATCCCGACAGCGCCCGCAAGAGGTTCAAGAAG
CTATTCGACTGTCCCATCCCAGAAGCGCCTGAGAGCAAGCGGCTGAGCGCGGATGACAAGGAGAGATTTAGCGCC
TTATGGCCCTGTGGTGAGCACGCCGCTGCCGAGCGGCTGGCCAAGTTTTGCCAGGAAAAGATTGGCCAGTATCAC
GAGAAGCGCAATATCCCTGCCGACGACGGCACCTCGAGCATGTCGGTTCATCTGGCCAGCGGCACCATTAGTTCA
AGGACATGTGTCCGCACCGCCCGGGACCATAACACGACAAAGAAGCTCGATGGCGGCAACGAAGGTATCATGTCG
TGGATCAGCGAGGTTGCCTGGCGGGAGTTTTACAAGCACGTCCTGGTGGCCTGGCCCTACGTGTGCATGAACAAA
CCATTCAAGCTACGATTCACTAGCATCGAGTGGTCCTATGACGAAGACCACTTTGCTGCCTGGTGCGAGGGCCGC
ACTGGTTTCCCCATCGTCGACGCCGCCATGCGCCAGCTCAACAGCATCGGCTACATGCACAACCGCTGTCGCATG
ATCGTAGCCTCCTTCCTGGCCAAAGACCTTCTCATCGACTGGCGCAAAGGCGAGCGCTACTTCATGGAGCACCTG
GTCGATGGCGATTTCGCGAGCAACAGTGGCGGCTGGGGGTTCAGCGCCAGCGTTGGTGTCGACCCGCAGCCGTAC
TTCCGCATCTTCAACCCGCTGCTGCAAAGCGAAAAATTCGACCCAAGCGGCGAGTACATCCGCAAATGGATACCC
GAGCTCAAAGATCTCGACAATAAGCAGATCCATGACCCGTACGGTCGTGGCGGTGCGGTTCAGGCCAAGAAGAGC
GGATACCCAAAGCCCATCGTTAACCACAGCCAAATGCGCCTCCAAACGCTTGAGAAATACAGAATTGCACCCGGA
GACACGTCTTGTTTGAAAGAATAA
Transcript >Ophcf2|02567
ATGAAATATTCTCTGACCGCAGAGGGCACGGGAGGGAAACGACTCAAGAAGGAGAGCGACTTGCGTGGGCCTCAT
CCGTTGGCGAAAGACTCCGCGCAGCAGGGCATCGTGCTTCGAAAATTCTACCCCCCGGAGATGACCAACCGCCGA
GCTCTGGCTTACGCTGAAGGTGAAATCATACGTCCCATCAACGAGCTCATCTGCGTTCTCGACGACACGGAGAAG
AAGCGCGAGGCCGTCAAAGTTGGTCGTTCCGTTGTCCATTGGTTCAAGACGGACCTCCGCCACAAAGACAACAGG
GCCCTTGCCATGGCCAGCGACAAGGCCAAGTCGGCCGGCGTACCGCTCATCTGCATCTATCTCGTCAGCCCTCAA
GACTTTGAGGCCCACCTCATGGCGCCTATCCGGGTCGACTTTGTGCTGAGGACACTTGATGTGTTGCGTCGTGAC
CTGGCGCGTCTCGACATCCCGCTCTTTGTTGAGACGGTCGACAAGAGGAAAAAGCTGCCCGGTCGCATCATGGAA
CTCATGGAGGAATGGGGCAGCAATCACCTTTTTGCCAACATGGAGTACGAGGTCGACGAGCTGCGACGAGAGGCG
CGTTTAGTCCGCGAACTCTCCCAGGTCGGCAAGTCCTTTGATGTCGTCCACGACACCTGCGTCGTCAAACCGGGG
AATATCAGGGCCAGCACCGGGAGGCAGTTTTCCGTCTATAGTCATTGGTTTCGCAACTGGCACAGACTCATCTAC
TCCCATCCGGATTGGCTCGAGCTCTCCGATCCGCCAGCCAAGAATCCCGACAGCGCCCGCAAGAGGTTCAAGAAG
CTATTCGACTGTCCCATCCCAGAAGCGCCTGAGAGCAAGCGGCTGAGCGCGGATGACAAGGAGAGATTTAGCGCC
TTATGGCCCTGTGGTGAGCACGCCGCTGCCGAGCGGCTGGCCAAGTTTTGCCAGGAAAAGATTGGCCAGTATCAC
GAGAAGCGCAATATCCCTGCCGACGACGGCACCTCGAGCATGTCGGTTCATCTGGCCAGCGGCACCATTAGTTCA
AGGACATGTGTCCGCACCGCCCGGGACCATAACACGACAAAGAAGCTCGATGGCGGCAACGAAGGTATCATGTCG
TGGATCAGCGAGGTTGCCTGGCGGGAGTTTTACAAGCACGTCCTGGTGGCCTGGCCCTACGTGTGCATGAACAAA
CCATTCAAGCTACGATTCACTAGCATCGAGTGGTCCTATGACGAAGACCACTTTGCTGCCTGGTGCGAGGGCCGC
ACTGGTTTCCCCATCGTCGACGCCGCCATGCGCCAGCTCAACAGCATCGGCTACATGCACAACCGCTGTCGCATG
ATCGTAGCCTCCTTCCTGGCCAAAGACCTTCTCATCGACTGGCGCAAAGGCGAGCGCTACTTCATGGAGCACCTG
GTCGATGGCGATTTCGCGAGCAACAGTGGCGGCTGGGGGTTCAGCGCCAGCGTTGGTGTCGACCCGCAGCCGTAC
TTCCGCATCTTCAACCCGCTGCTGCAAAGCGAAAAATTCGACCCAAGCGGCGAGTACATCCGCAAATGGATACCC
GAGCTCAAAGATCTCGACAATAAGCAGATCCATGACCCGTACGGTCGTGGCGGTGCGGTTCAGGCCAAGAAGAGC
GGATACCCAAAGCCCATCGTTAACCACAGCCAAATGCGCCTCCAAACGCTTGAGAAATACAGAATTGCACCCGGA
GACACGTCTTGTTTGAAAGAATAA
Gene >Ophcf2|02567
ATGAAATATTCTCTGACCGCAGAGGGCACGGGAGGGAAACGACTCAAGAAGGAGAGCGACTTGCGTGGGCCTCAT
CCGTTGGCGAAAGACTCCGCGCAGCAGGGCATCGTGCTTCGAAAATTCTACCCCCCGGAGATGACCAACCGCCGA
GCTCTGGCTTACGCTGAAGGTGAAATCATACGTCCCATCAACGAGCTCATCTGCGTTCTCGACGACACGGAGAAG
AAGCGCGAGGCCGTCAAAGTTGGTCGTTCCGTTGTCCATTGGTTCAAGACGGACCTCCGCCACAAAGACAACAGG
GCCCTTGCCATGGCCAGCGACAAGGCCAAGTCGGCCGGCGTACCGCTCATCTGCATCTATCTCGTCAGCCCTCAA
GACTTTGAGGCCCACCTCATGGCGCCTATCCGGGTCGACTTTGTGCTGAGGACACTTGATGTGTTGCGTCGTGAC
CTGGCGCGTCTCGACATCCCGCTCTTTGTTGAGACGGTCGACAAGAGGAAAAAGCTGCCCGGTCGCATCATGGAA
CTCATGGAGGAATGGGGCAGCAATCACCTTTTTGCCAACATGGAGTACGAGGTCGACGAGCTGCGACGAGAGGCG
CGTTTAGTCCGCGAACTCTCCCAGGTCGGCAAGTCCTTTGATGTCGTCCACGACACCTGCGTCGTCAAACCGGGG
AATATCAGGGCCAGCACCGGGAGGCAGTTTTCCGTCTATAGTCATTGGTTTCGCAACTGGCACAGACTCATCTAC
TCCCATCCGGATTGGCTCGAGCTCTCCGATCCGCCAGCCAAGAATCCCGACAGCGCCCGCAAGAGGTTCAAGAAG
CTATTCGACTGTCCCATCCCAGAAGCGCCTGAGAGCAAGCGGCTGAGCGCGGATGACAAGGAGAGATTTAGCGCC
TTATGGCCCTGTGGTGAGCACGCCGCTGCCGAGCGGCTGGCCAAGTTTTGCCAGGAAAAGATTGGCCAGTATCAC
GAGAAGCGCAATATCCCTGCCGACGACGGCACCTCGAGCATGTCGGTTCATCTGGCCAGCGGCACCATTAGTTCA
AGGACATGTGTCCGCACCGCCCGGGACCATAACACGACAAAGAAGCTCGATGGCGGCAACGAAGGTATCATGTCG
TGGATCAGCGAGGTTGCCTGGCGGGAGTTTTACAAGCACGTCCTGGTGGCCTGGCCCTACGTGTGGTGAGTCTCT
TCAACGCCTTCTTTGCTATCGAGCGACGCTGAGGCAACAAGGCAGCATGAACAAACCATTCAAGCTACGATTCAC
TAGCATCGAGTGGTCCTATGACGAAGACCACTTTGCTGCCTGGTGCGAGGGCCGCACTGGTTTCCCCATCGTCGA
CGCCGCCATGCGCCAGCTCAACAGCATCGGCTACATGCACAACCGCTGTCGCATGATCGTAGCCTCCTTCCTGGC
CAAAGACCTTCTCATCGACTGGCGCAAAGGCGAGCGCTACTTCATGGAGCACCTGGTCGATGGCGATTTCGCGAG
CAACAGTGGCGGCTGGGGGTTCAGCGCCAGCGTTGGTGTCGACCCGCAGCCGTACTTCCGCATCTTCAACCCGCT
GCTGCAAAGCGAAAAATTCGACCCAAGCGGCGAGTACATCCGCAAATGGATACCCGAGCTCAAAGATCTCGACAA
TAAGCAGATCCATGACCCGTACGGTCGTGGCGGTGCGGTTCAGGCCAAGAAGAGCGGATACCCAAAGCCCATCGT
TAACCACAGCCAAATGCGCCTCCAAACGCTTGAGAAATACAGAATTGCACCCGGAGACACGTCTTGTTTGAAAGA
ATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail