Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02557
Gene name
Locationscaffold_02:4074054..4074573
Strand+
Gene length (bp)519
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 5.1E-09 32 115

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.3712 0.1932 0.0245 0.0885 0.8551 0.1615 0.1168 0.1008 0.084 0.0341

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3607
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5876
Ophiocordyceps australis map64 (Brazil) OphauB2|75
Ophiocordyceps camponoti-floridani Ophcf2|02557 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3590
Ophiocordyceps kimflemingae Ophio5|987
Ophiocordyceps subramaniannii Hirsu2|6959

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02557
MRVAIPRIFVNRLTSLRNPPKTITESPSLHINSEEDFTSLLKSNTYVVVNFTTSWTPSCRGSVDAIYDTLACNHS
IPESLAFGRVNVDRFEPIARKYGVTILPSYVFFQHAKQVSVNKHAMIRGADIDFLIVACDRFRELAVTQVIKQAK
PSFPS*
Coding >Ophcf2|02557
ATGCGCGTCGCCATCCCTCGAATCTTCGTCAATCGCTTGACCTCACTCCGAAATCCTCCCAAAACGATTACAGAA
AGTCCTTCTCTACATATCAATTCTGAAGAAGACTTCACCTCTCTACTCAAGTCGAATACGTACGTCGTCGTCAAC
TTTACCACTAGCTGGACCCCATCGTGTCGGGGCTCGGTCGATGCCATTTATGACACCTTGGCTTGCAATCATAGC
ATCCCCGAATCGCTGGCCTTTGGACGAGTGAATGTCGACCGTTTCGAGCCCATCGCGAGGAAGTATGGTGTCACC
ATCTTGCCAAGCTATGTATTCTTCCAGCACGCGAAGCAGGTCTCCGTCAACAAGCACGCCATGATTCGCGGCGCC
GATATCGACTTCTTGATTGTTGCTTGCGACAGGTTTAGAGAACTAGCCGTCACACAAGTCATCAAACAAGCCAAA
CCCAGCTTTCCGAGCTGA
Transcript >Ophcf2|02557
ATGCGCGTCGCCATCCCTCGAATCTTCGTCAATCGCTTGACCTCACTCCGAAATCCTCCCAAAACGATTACAGAA
AGTCCTTCTCTACATATCAATTCTGAAGAAGACTTCACCTCTCTACTCAAGTCGAATACGTACGTCGTCGTCAAC
TTTACCACTAGCTGGACCCCATCGTGTCGGGGCTCGGTCGATGCCATTTATGACACCTTGGCTTGCAATCATAGC
ATCCCCGAATCGCTGGCCTTTGGACGAGTGAATGTCGACCGTTTCGAGCCCATCGCGAGGAAGTATGGTGTCACC
ATCTTGCCAAGCTATGTATTCTTCCAGCACGCGAAGCAGGTCTCCGTCAACAAGCACGCCATGATTCGCGGCGCC
GATATCGACTTCTTGATTGTTGCTTGCGACAGGTTTAGAGAACTAGCCGTCACACAAGTCATCAAACAAGCCAAA
CCCAGCTTTCCGAGCTGA
Gene >Ophcf2|02557
ATGCGCGTCGCCATCCCTCGAATCTTCGTCAATCGCTTGACCTCACTCCGAAATCCTCCCAAAACGATTACAGAA
AGTCCTTCTCTACATATCAATTCTGAAGAAGACTTCACCTCTCTACTCAAGTCGAATACGTACGTCGTCGTCAAC
TTTACCACTAGCTGTATGAGGCCCTCAGACGTCCTTGTTTAAATATGCGCTGATGAAACAGTAGGGACCCCATCG
TGTCGGGGCTCGGTCGATGCCATTTATGACACCTTGGCTTGCAATCATAGCATCCCCGAATCGCTGGCCTTTGGA
CGAGTGAATGTCGACCGTTTCGAGCCCATCGCGAGGAAGTATGGTGTCACCATCTTGCCAAGCTATGTATTCTTC
CAGCACGCGAAGCAGGTCTCCGTCAACAAGCACGCCATGATTCGCGGCGCCGATATCGACTTCTTGATTGTTGCT
TGCGACAGGTTTAGAGAACTAGCCGTCACACAAGTCATCAAACAAGCCAAACCCAGCTTTCCGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail