Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02552
Gene name
Locationscaffold_02:4061743..4063908
Strand+
Gene length (bp)2165
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07287 AtuA Acyclic terpene utilisation family protein AtuA 3.1E-126 13 388

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6127 0.6349 0.0147 0.0485 0.1181 0.0277 0.0498 0.3739 0.0665 0.0526

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4598
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3927
Ophiocordyceps australis map64 (Brazil) OphauB2|7987
Ophiocordyceps camponoti-floridani Ophcf2|02552 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3595
Ophiocordyceps kimflemingae Ophio5|982
Ophiocordyceps subramaniannii Hirsu2|9653

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02552
MTPFSSFRRPVRIANCSGASTDAGVHMLRQATLGPVDVITGDYLAEGTVGNDALRRADQAHPGWVASALAGIEMS
LEVINEKRIKIVVNGGSLNPKGLAEKIDGMVRDGRLNLRVAFVDGDDVLPKFEAIMSSISPSAKPLPHLDSGNSN
VVLPDETFSFLRDREAMPVLSANAYLGYRAIKRGLDEGADIIICGRVADASPVIAAAAWWYGWAESDFDRLAGAL
IAGHLIECSTYVTGANFAGAYKYPPSSFVDLGLPIAEVAEDGESIITKHQGTGGFVTPDTVKCQFLYELQGTVYL
NSDVKADVKNVEITAQGKDRVHVSGIRGFPPPPTTKLAIFYRGGYQLEMLVNATGYSTDHKCAVQEAQVRAKLRE
WGTLDDMHVLDFQKVGVPMENPDSQLAATTYLRIFAQAKEPHIVASVTQAVVFVFMAHFAGMNGYLQNLQAFPTP
FMGYYPALISQSEIEEAVTLLDSNPSSRPPLRIKVGPPKTTQELASRESYETSNPVPLDSFGPKTMRPLGDVILA
RSGDKGANVNLGLFVHTDEQYDWLRSIMTRDRLRALMRRDWRDCYHVERVEMPRIRAVHFVVYGPLGRGVSSSQR
LDCLGKGFAEFIRAIWLPIPNRFLQEEAAKL*
Coding >Ophcf2|02552
ATGACGCCCTTTTCTTCCTTCAGACGCCCCGTTAGAATCGCCAACTGCTCCGGTGCCTCGACCGATGCCGGCGTG
CACATGCTGAGACAGGCGACGCTGGGACCTGTAGACGTCATCACCGGTGACTACCTAGCAGAGGGGACCGTCGGC
AACGATGCTCTCAGGAGGGCGGACCAGGCTCATCCCGGATGGGTAGCTTCGGCCCTCGCCGGCATCGAAATGTCG
CTCGAGGTGATCAACGAGAAGCGTATCAAGATTGTCGTCAATGGCGGATCGCTTAACCCCAAGGGCTTGGCTGAG
AAGATTGACGGCATGGTGAGAGACGGTCGTCTGAACCTCCGCGTCGCCTTTGTGGATGGCGACGATGTCCTCCCC
AAGTTTGAAGCCATCATGAGCTCCATCTCCCCTTCAGCTAAACCGCTACCGCATCTAGACAGCGGAAACAGCAAC
GTCGTCCTCCCCGACGAGACGTTCTCCTTTCTGCGAGATCGGGAGGCGATGCCCGTCCTCTCCGCCAACGCTTAC
CTCGGCTACCGCGCCATCAAAAGGGGTCTCGACGAGGGAGCCGACATCATCATCTGCGGCCGCGTGGCCGATGCT
TCTCCCGTCATTGCCGCGGCTGCCTGGTGGTACGGATGGGCCGAGTCTGACTTTGATAGGCTTGCGGGCGCTCTC
ATCGCTGGCCATCTGATTGAGTGCTCGACTTACGTGACGGGTGCCAACTTTGCTGGTGCGTACAAGTATCCTCCC
AGCAGCTTCGTCGATCTCGGGCTTCCCATCGCCGAGGTGGCCGAGGACGGGGAGTCCATCATCACCAAGCATCAA
GGAACCGGTGGTTTCGTCACGCCGGACACGGTCAAGTGTCAGTTCCTCTACGAGCTGCAAGGAACAGTCTACCTC
AACAGCGATGTGAAAGCCGACGTCAAGAACGTCGAGATAACAGCCCAGGGCAAGGATCGCGTTCACGTCTCGGGG
ATCAGGGGCTTCCCACCACCGCCGACGACCAAGCTGGCCATCTTCTACCGCGGAGGTTACCAGCTCGAGATGCTG
GTCAACGCCACGGGCTACTCTACCGACCACAAGTGTGCCGTCCAGGAGGCCCAGGTCCGGGCCAAGCTGCGGGAA
TGGGGCACGCTGGATGACATGCATGTCTTGGACTTTCAGAAGGTAGGGGTGCCCATGGAGAATCCGGACTCGCAG
CTGGCGGCTACGACGTACTTGCGCATCTTTGCTCAGGCAAAGGAGCCGCATATCGTTGCCAGTGTTACCCAGGCC
GTGGTGTTTGTCTTTATGGCTCATTTCGCCGGGATGAACGGGTATTTGCAAAATCTACAAGCCTTTCCAACCCCA
TTCATGGGATACTATCCAGCCCTTATCTCTCAGAGCGAGATCGAAGAAGCAGTCACCCTCCTCGACTCCAACCCT
TCATCCCGGCCTCCTCTACGAATCAAGGTCGGACCCCCCAAAACCACCCAGGAGCTTGCCAGCCGCGAAAGCTAC
GAAACATCAAACCCAGTGCCACTGGACTCCTTCGGGCCCAAGACGATGCGCCCTCTCGGCGACGTCATCCTAGCC
CGGTCCGGAGACAAGGGAGCCAACGTCAATCTCGGCCTCTTCGTTCACACGGATGAGCAGTACGACTGGCTTCGG
TCCATCATGACGAGGGATAGGCTTAGGGCGCTGATGCGCAGGGACTGGCGGGACTGCTATCACGTCGAGCGGGTC
GAGATGCCACGCATCCGGGCCGTGCACTTTGTCGTCTACGGACCCCTGGGACGGGGCGTCAGTAGCTCTCAGAGG
CTAGACTGCTTGGGCAAGGGTTTTGCTGAGTTTATACGCGCTATCTGGCTTCCCATTCCGAACAGGTTTCTGCAG
GAAGAGGCTGCCAAGTTGTGA
Transcript >Ophcf2|02552
ATGACGCCCTTTTCTTCCTTCAGACGCCCCGTTAGAATCGCCAACTGCTCCGGTGCCTCGACCGATGCCGGCGTG
CACATGCTGAGACAGGCGACGCTGGGACCTGTAGACGTCATCACCGGTGACTACCTAGCAGAGGGGACCGTCGGC
AACGATGCTCTCAGGAGGGCGGACCAGGCTCATCCCGGATGGGTAGCTTCGGCCCTCGCCGGCATCGAAATGTCG
CTCGAGGTGATCAACGAGAAGCGTATCAAGATTGTCGTCAATGGCGGATCGCTTAACCCCAAGGGCTTGGCTGAG
AAGATTGACGGCATGGTGAGAGACGGTCGTCTGAACCTCCGCGTCGCCTTTGTGGATGGCGACGATGTCCTCCCC
AAGTTTGAAGCCATCATGAGCTCCATCTCCCCTTCAGCTAAACCGCTACCGCATCTAGACAGCGGAAACAGCAAC
GTCGTCCTCCCCGACGAGACGTTCTCCTTTCTGCGAGATCGGGAGGCGATGCCCGTCCTCTCCGCCAACGCTTAC
CTCGGCTACCGCGCCATCAAAAGGGGTCTCGACGAGGGAGCCGACATCATCATCTGCGGCCGCGTGGCCGATGCT
TCTCCCGTCATTGCCGCGGCTGCCTGGTGGTACGGATGGGCCGAGTCTGACTTTGATAGGCTTGCGGGCGCTCTC
ATCGCTGGCCATCTGATTGAGTGCTCGACTTACGTGACGGGTGCCAACTTTGCTGGTGCGTACAAGTATCCTCCC
AGCAGCTTCGTCGATCTCGGGCTTCCCATCGCCGAGGTGGCCGAGGACGGGGAGTCCATCATCACCAAGCATCAA
GGAACCGGTGGTTTCGTCACGCCGGACACGGTCAAGTGTCAGTTCCTCTACGAGCTGCAAGGAACAGTCTACCTC
AACAGCGATGTGAAAGCCGACGTCAAGAACGTCGAGATAACAGCCCAGGGCAAGGATCGCGTTCACGTCTCGGGG
ATCAGGGGCTTCCCACCACCGCCGACGACCAAGCTGGCCATCTTCTACCGCGGAGGTTACCAGCTCGAGATGCTG
GTCAACGCCACGGGCTACTCTACCGACCACAAGTGTGCCGTCCAGGAGGCCCAGGTCCGGGCCAAGCTGCGGGAA
TGGGGCACGCTGGATGACATGCATGTCTTGGACTTTCAGAAGGTAGGGGTGCCCATGGAGAATCCGGACTCGCAG
CTGGCGGCTACGACGTACTTGCGCATCTTTGCTCAGGCAAAGGAGCCGCATATCGTTGCCAGTGTTACCCAGGCC
GTGGTGTTTGTCTTTATGGCTCATTTCGCCGGGATGAACGGGTATTTGCAAAATCTACAAGCCTTTCCAACCCCA
TTCATGGGATACTATCCAGCCCTTATCTCTCAGAGCGAGATCGAAGAAGCAGTCACCCTCCTCGACTCCAACCCT
TCATCCCGGCCTCCTCTACGAATCAAGGTCGGACCCCCCAAAACCACCCAGGAGCTTGCCAGCCGCGAAAGCTAC
GAAACATCAAACCCAGTGCCACTGGACTCCTTCGGGCCCAAGACGATGCGCCCTCTCGGCGACGTCATCCTAGCC
CGGTCCGGAGACAAGGGAGCCAACGTCAATCTCGGCCTCTTCGTTCACACGGATGAGCAGTACGACTGGCTTCGG
TCCATCATGACGAGGGATAGGCTTAGGGCGCTGATGCGCAGGGACTGGCGGGACTGCTATCACGTCGAGCGGGTC
GAGATGCCACGCATCCGGGCCGTGCACTTTGTCGTCTACGGACCCCTGGGACGGGGCGTCAGTAGCTCTCAGAGG
CTAGACTGCTTGGGCAAGGGTTTTGCTGAGTTTATACGCGCTATCTGGCTTCCCATTCCGAACAGGTTTCTGCAG
GAAGAGGCTGCCAAGTTGTGA
Gene >Ophcf2|02552
ATGACGCCCTTTTCTTCCTTCAGACGCCCCGTTAGAATCGCCAACTGCTCCGGTGCCTCGAGTGAGTGAAGCTCT
CCCGGCCCGGAACGATGCTCACCCGCCGTCGCAGCCGATGCCGGCGTGCACATGCTGAGACAGGCGACGCTGGGA
CCTGTAGACGTCATCACCGGTGACTACCTAGCAGGTATGGCCTCGAGCTTCGTCTGACGGCGGTGACGAGGAGGC
TGATGGTGCCGTGATGGGGTCAGAGGGGACCGTCGGCAACGATGCTCTCAGGAGGGCGGACCAGGCTCATCCCGG
ATGGGTAGCTTCGGCCCTCGCCGGCATCGAAATGTCGCTCGAGGTGATCAACGAGAAGCGTATCAAGATTGTCGT
CAATGGCGGATCGCTTAACCCCAAGGGCTTGGCTGAGAAGATTGACGGCATGGTACGTTGCCTGATAACATGAGA
AATGAGAGTGTCATTGAAGTAACAAGCTCGTCAAAGGTGAGAGACGGTCGTCTGAACCTCCGCGTCGCCTTTGTG
GATGGCGACGATGTCCTCCCCAAGTTTGAAGCCATCATGAGCTCCATCTCCCCTTCAGCTAAACCGCTACCGCAT
CTAGACAGCGGAAACAGCAACGTCGTCCTCCCCGACGAGACGTTCTCCTTTCTGCGAGATCGGGAGGCGATGCCC
GTCCTCTCCGCCAACGCTTACCTCGGCTACCGCGCCATCAAAAGGGGTCTCGACGAGGGAGCCGACATCATCATC
TGCGGCCGCGTGGCCGATGCTTCTCCCGTCATTGCCGCGGCTGCCTGGTGGTACGGATGGGCCGAGTCTGACTTT
GATAGGCTTGCGGGCGCTCTCATCGCTGGCCATCTGATTGAGTGCTCGACTTACGTGACGGGTGCCAACTTTGCT
GGTGCGTACAAGTATCCTCCCAGCAGCTTCGTCGATCTCGGGCTTCCCATCGCCGAGGTGGCCGAGGACGGGGAG
TCCATCATCACCAAGCATCAAGGAACCGGTGGTTTCGTCACGCCGGACACGGTCAAGTGTCAGTTCCTCTACGAG
CTGCAAGGAACAGTCTACCTCAACAGCGATGTGAAAGCCGACGTCAAGAACGTCGAGATAACAGCCCAGGGCAAG
GATCGCGTTCACGTCTCGGGGATCAGGGGCTTCCCACCACCGCCGACGACCAAGCTGGCCATCTTCTACCGCGGA
GGTTACCAGCTCGAGATGCTGGTCAACGCCACGGGCTACTCTACCGACCACAAGTGTGCCGTCCAGGAGGCCCAG
GTCCGGGCCAAGCTGCGGGAATGGGGCACGCTGGATGACATGCATGTCTTGGACTTTCAGAAGGTAGGGGTGCCC
ATGGAGAATCCGGACTCGCAGCTGGCGGCTACGACGTACTTGCGCATCTTTGCTCAGGCAAAGGAGCCGCATATC
GTTGCCAGTGTTACCCAGGCCGTGGTGTTTGTCTTTATGGCTCATTTCGCCGGTAAGTATAGAATGATTTCACAC
ATATACTGACTGATATCAATCATTGATGTCTGAAGGGTTGAGAGATGAGCTGACTCGACCTTGACCTGCAAATAG
GGATGAACGGGTATTTGCAAAATCTACAAGCCTTTCCAACCCCATTCATGGGATACTATCCAGCCCTTATCTCTC
AGAGCGAGATCGAAGAAGCAGTCACCCTCCTCGACTCCAACCCTTCATCCCGGCCTCCTCTACGAATCAAGGTCG
GACCCCCCAAAACCACCCAGGAGCTTGCCAGCCGCGAAAGCTACGAAACATCAAACCCAGTGCCACTGGACTCCT
TCGGGCCCAAGACGATGCGCCCTCTCGGCGACGTCATCCTAGCCCGGTCCGGAGACAAGGGAGCCAACGTCAATC
TCGGCCTCTTCGTTCACACGGATGAGCAGTACGACTGGCTTCGGTCCATCATGACGAGGGATAGGCTTAGGGCGC
TGATGCGCAGGGACTGGCGGGACTGCTATCACGTCGAGCGGGTCGAGATGCCACGCATCCGGGCCGTGCACTTTG
TCGTCTACGGACCCCTGGGACGGGGCGTCAGTAGCTCTCAGAGGCTAGACTGCTTGGGCAAGGGTTTTGCTGAGT
TTATACGCGCTATCTGGCTTCCCATTCCGAACAGGTTTCTGCAGGAAGAGGCTGCCAAGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail