Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02548
Gene name
Locationscaffold_02:4056081..4057125
Strand+
Gene length (bp)1044
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00549 Ligase_CoA CoA-ligase 4.9E-19 170 287
PF08442 ATP-grasp_2 ATP-grasp domain 3.0E-18 2 110

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.6406 0.6834 0.0147 0.0423 0.3078 0.1611 0.177 0.0459 0.0746 0.2936

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5049
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3406
Ophiocordyceps australis map64 (Brazil) OphauB2|3852
Ophiocordyceps camponoti-floridani Ophcf2|02548 (this protein)
Ophiocordyceps kimflemingae Ophio5|978
Ophiocordyceps subramaniannii Hirsu2|271

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02548
MKKLRVTEHIKSDANWYLAMSVDRESYGPAITISRRGGMTVDEIARLYPDSLYTFSFTLSTGITTSLMSQIQTQL
QLSSVQSGNLEHLLHQAFAIFSQKDATLFEINPMTMSKDGSIASLSTNLVIDDAAKKRQPELFLLRDKSKEVAEE
VEAEEHGLVYVKMEGDIGVVVNGAGLAMATNDAIGFHGGKSANFLDTGGKATTETMLKAFEIVTRDERVRAILVN
IYGGLTRCDMMAESIIGAARELDMRVPMVVRLQGTNSEQGLKMLEEAGLGIDMVVESDWRAARRVVELARGVEST
NTC*
Coding >Ophcf2|02548
ATGAAAAAGCTGCGCGTGACGGAACACATCAAGTCTGACGCAAACTGGTATCTCGCCATGTCAGTCGACAGAGAG
AGCTACGGACCGGCCATTACTATTTCGAGGCGAGGCGGTATGACCGTCGATGAGATAGCCAGGCTCTACCCCGAC
AGCCTCTACACCTTTTCCTTTACCCTCTCAACTGGCATCACGACAAGCCTAATGTCACAGATTCAGACACAACTC
CAGCTATCAAGCGTCCAATCCGGAAATCTCGAGCACCTCCTACACCAAGCATTCGCCATCTTCTCTCAGAAAGAC
GCGACACTCTTCGAAATCAACCCGATGACCATGTCGAAAGACGGAAGCATAGCCAGCCTCAGCACAAACCTCGTC
ATCGACGACGCCGCAAAGAAACGCCAGCCGGAACTGTTCCTCCTCCGGGATAAAAGCAAAGAAGTAGCGGAAGAA
GTCGAGGCGGAGGAGCACGGCTTGGTATACGTCAAGATGGAGGGAGACATCGGCGTCGTCGTGAACGGGGCCGGA
CTTGCAATGGCGACCAACGATGCCATCGGCTTTCACGGCGGGAAGAGCGCAAACTTTCTCGATACGGGCGGGAAG
GCGACTACGGAGACGATGCTCAAGGCATTCGAGATTGTAACGCGAGACGAGAGGGTGAGGGCTATCCTCGTCAAC
ATCTACGGGGGCCTCACCCGCTGCGACATGATGGCCGAGTCCATCATCGGCGCCGCGCGGGAGCTGGACATGCGG
GTGCCGATGGTAGTCCGACTTCAGGGAACCAACTCGGAGCAGGGTCTCAAGATGCTCGAGGAGGCTGGCTTGGGT
ATCGACATGGTGGTTGAGTCGGACTGGCGGGCGGCACGGCGGGTGGTAGAGCTGGCAAGAGGAGTTGAGTCTACG
AATACCTGTTGA
Transcript >Ophcf2|02548
ATGAAAAAGCTGCGCGTGACGGAACACATCAAGTCTGACGCAAACTGGTATCTCGCCATGTCAGTCGACAGAGAG
AGCTACGGACCGGCCATTACTATTTCGAGGCGAGGCGGTATGACCGTCGATGAGATAGCCAGGCTCTACCCCGAC
AGCCTCTACACCTTTTCCTTTACCCTCTCAACTGGCATCACGACAAGCCTAATGTCACAGATTCAGACACAACTC
CAGCTATCAAGCGTCCAATCCGGAAATCTCGAGCACCTCCTACACCAAGCATTCGCCATCTTCTCTCAGAAAGAC
GCGACACTCTTCGAAATCAACCCGATGACCATGTCGAAAGACGGAAGCATAGCCAGCCTCAGCACAAACCTCGTC
ATCGACGACGCCGCAAAGAAACGCCAGCCGGAACTGTTCCTCCTCCGGGATAAAAGCAAAGAAGTAGCGGAAGAA
GTCGAGGCGGAGGAGCACGGCTTGGTATACGTCAAGATGGAGGGAGACATCGGCGTCGTCGTGAACGGGGCCGGA
CTTGCAATGGCGACCAACGATGCCATCGGCTTTCACGGCGGGAAGAGCGCAAACTTTCTCGATACGGGCGGGAAG
GCGACTACGGAGACGATGCTCAAGGCATTCGAGATTGTAACGCGAGACGAGAGGGTGAGGGCTATCCTCGTCAAC
ATCTACGGGGGCCTCACCCGCTGCGACATGATGGCCGAGTCCATCATCGGCGCCGCGCGGGAGCTGGACATGCGG
GTGCCGATGGTAGTCCGACTTCAGGGAACCAACTCGGAGCAGGGTCTCAAGATGCTCGAGGAGGCTGGCTTGGGT
ATCGACATGGTGGTTGAGTCGGACTGGCGGGCGGCACGGCGGGTGGTAGAGCTGGCAAGAGGAGTTGAGTCTACG
AATACCTGTTGA
Gene >Ophcf2|02548
ATGAAAAAGCTGCGCGTGACGGAACACATCAAGTCTGACGCAAACTGGTATCTCGCCATGTCAGTCGACAGAGAG
AGCTACGGACCGGCCATTACTATTTCGAGGCGAGGCGGTATGACCGTCGATGAGATAGCCAGGCTCTACCCCGAC
AGCCTCTACACCTTTTCCTTTACCCTCTCAACTGGCATCACGACAAGCCTAATGTCACAGATTCAGACACAACTC
CAGCTATCAAGCGTCCAATCCGGAAATCTCGAGCACCTCCTACACCAAGCATTCGCCATCTTCTCTCAGAAAGAC
GCGACACTCTTCGAAATCAACCCGATGACCATGTCGAAAGACGGAAGCATAGCCAGCCTCAGCACAAACCTCGTC
ATCGACGACGCCGCAAAGAAACGCCAGCCGGAACTGTTCCTCCTCCGGGATAAAAGCAAAGAAGTAGCGGAAGAA
GTCGAGGCGGAGGAGCACGGCTTGGTATACGTCAAGATGGAGGGAGACATCGGCGTCGTCGTGAACGGGGCCGGA
CTTGCAATGGCGACCAACGATGCCATCGGCTTTCACGGCGGGAAGAGCGCAAACTTTCTCGATACGGGCGGGAAG
GCGACTACGGAGACGATGCTCAAGGCATTCGAGATTGTAACGCGAGACGAGAGGGTGAGGGCTATCCTCGTCAAC
ATCTACGGGGGTGCGACTCAGCCCAGATTCCTCCCCTCGCAATCATGAAAAGGAACGAGCTGACAGGTCGACGTT
CAACACGTAGGCCTCACCCGCTGCGACATGATGGCCGAGTCCATCATCGGCGCCGCGCGGGAGCTGGACATGCGG
GTGCCGATGGTAGTCCGACTTCAGGGAACCAACTCGGAGCAGGGTCTCAAGATGGTGAGTCTGTTGTTTCTTTGC
TTGCCATCTTGACGGAATACTGACGTTTATGGAAAGCTCGAGGAGGCTGGCTTGGGTATCGACATGGTGGTTGAG
TCGGACTGGCGGGCGGCACGGCGGGTGGTAGAGCTGGCAAGAGGAGTTGAGTCTACGAATACCTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail