Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02546
Gene name
Locationscaffold_02:4051096..4053967
Strand+
Gene length (bp)2871
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25 3.8E-23 382 565

GO

GO Term Description Terminal node
GO:0009253 peptidoglycan catabolic process Yes
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0003796 lysozyme activity Yes
GO:0044036 cell wall macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0000270 peptidoglycan metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006022 aminoglycan metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009056 catabolic process No
GO:0009987 cellular process No
GO:0006027 glycosaminoglycan catabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0003674 molecular_function No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0061783 peptidoglycan muralytic activity No
GO:0030203 glycosaminoglycan metabolic process No
GO:1901575 organic substance catabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0006026 aminoglycan catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 104 126 22
3 130 147 17
4 160 182 22
5 186 208 22
6 229 251 22
7 271 293 22
8 314 336 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02546
MPVAVDDQSFEADDDAQLLPPTDTGRGAYVALACCTVSQAPIWGYSVSFGIFQEYYSNDSDIYGSPGAFASIGAA
QVGVMYLLMPVIFVLLHRRPRWRPWCGRLGLVITMASISASAFVSTVHGLIATQGVVYALGCALLFSPVSVYMDE
WFVRSKGAAYGVMWGGKSAVGVGMPFVFNAMLSRFGLSITLLSWAVASALLSLPALLLMKPRLPLPASGDARGSR
PLSWRFFRCTTFWMMQLGVVIQSLGYMMPSTYLASYALAIGLPSVTGPLLLAAFSLASVPGSIIHGFVGDKVSAS
KAILVSSFGSALPVFLLWGLSLHFANVMAFALAFGFFAGRTPLHEANDSKNPTTQMRPFQAFTSALVASTAAVAA
DTMLGFDASSVHGAVDFGQAYADGARFAIMRTTGGSSHVDRAFGQFQQQAADAGLIRGGYHVGQPERAFGGIQAK
YFLQNGGGWIDDGKTLPGMIMLTDRDHREARTCHGMTPKEIQRWIIEFTEVYRASTSIYPMLYTTTGWWKQCTGN
TVNLMNRALLVVSDHGERLGELPAGWKKHTFWEYSADSPWAGRSYVFNGDESGLNRTALVGRPE*
Coding >Ophcf2|02546
ATGCCTGTTGCTGTTGACGACCAGAGTTTCGAAGCCGACGACGATGCACAGCTTCTACCGCCTACAGACACCGGA
AGAGGGGCCTACGTGGCTCTCGCGTGCTGCACCGTCTCCCAAGCTCCCATCTGGGGATACTCGGTCTCGTTCGGC
ATCTTCCAAGAATACTACAGCAACGACAGCGACATCTACGGCTCTCCCGGTGCCTTTGCCTCCATCGGAGCCGCT
CAGGTGGGCGTCATGTACCTCCTGATGCCCGTCATCTTCGTCCTCCTCCACCGCAGACCGCGATGGCGCCCCTGG
TGCGGAAGACTAGGCCTCGTCATCACCATGGCCAGCATCTCGGCCTCGGCCTTCGTCTCGACCGTCCACGGCCTC
ATCGCTACTCAGGGGGTCGTGTATGCTCTCGGCTGCGCGCTGCTCTTTAGCCCCGTCTCCGTCTATATGGATGAG
TGGTTCGTTCGCTCCAAGGGGGCGGCTTACGGTGTCATGTGGGGAGGGAAGTCGGCTGTTGGTGTCGGCATGCCC
TTTGTTTTCAACGCCATGCTGAGCCGCTTCGGCTTGAGCATCACGCTTCTCTCCTGGGCTGTTGCTTCGGCTCTC
TTGTCGCTGCCGGCTCTCCTTCTCATGAAGCCCCGGTTACCTCTACCCGCTTCTGGCGACGCCCGTGGCTCCAGG
CCGCTGTCCTGGCGCTTCTTCCGCTGCACAACCTTCTGGATGATGCAGTTGGGCGTCGTGATACAATCGCTGGGC
TACATGATGCCCTCTACGTATCTGGCCAGCTACGCCTTGGCCATCGGCTTGCCCTCGGTCACGGGGCCGCTGCTC
CTGGCCGCCTTCTCGTTGGCTTCGGTGCCCGGTTCCATAATCCACGGGTTCGTCGGCGACAAGGTGTCTGCCAGC
AAGGCCATCTTGGTGTCTTCGTTCGGAAGCGCCCTCCCAGTCTTTCTGCTCTGGGGTCTCAGCCTTCACTTTGCG
AATGTCATGGCTTTTGCACTAGCTTTTGGCTTCTTCGCCGGACGGACTCCCCTACATGAAGCCAACGATAGCAAG
AATCCAACAACACAGATGAGACCCTTTCAAGCCTTCACCAGTGCTCTGGTCGCCAGCACGGCCGCCGTTGCGGCT
GACACGATGCTGGGCTTCGACGCTTCGAGCGTTCATGGCGCCGTCGACTTTGGTCAGGCCTACGCTGATGGAGCT
CGCTTCGCCATCATGAGGACGACGGGAGGTTCTAGCCACGTGGATCGTGCATTCGGGCAATTCCAGCAACAAGCC
GCAGACGCAGGCCTGATCCGCGGAGGCTACCACGTCGGCCAGCCGGAGAGGGCCTTTGGCGGCATCCAGGCCAAG
TACTTTCTCCAGAACGGCGGCGGCTGGATTGACGACGGGAAGACGCTGCCCGGAATGATCATGTTGACGGATAGA
GACCACCGGGAGGCGCGAACCTGCCACGGCATGACGCCCAAGGAGATTCAGCGCTGGATCATCGAGTTCACCGAG
GTCTACCGCGCTTCGACGAGCATCTACCCCATGTTATACACGACTACGGGATGGTGGAAGCAGTGCACTGGCAAC
ACGGTCAATCTCATGAACCGCGCTCTGTTAGTCGTCTCGGATCACGGTGAGAGGCTCGGTGAGCTGCCGGCGGGG
TGGAAGAAGCACACTTTCTGGGAGTATTCGGCCGATTCTCCTTGGGCGGGCAGATCTTATGTCTTTAACGGCGAT
GAGTCGGGGCTTAACAGGACGGCTCTGGTTGGGCGTCCGGAGTAA
Transcript >Ophcf2|02546
ATGCCTGTTGCTGTTGACGACCAGAGTTTCGAAGCCGACGACGATGCACAGCTTCTACCGCCTACAGACACCGGA
AGAGGGGCCTACGTGGCTCTCGCGTGCTGCACCGTCTCCCAAGCTCCCATCTGGGGATACTCGGTCTCGTTCGGC
ATCTTCCAAGAATACTACAGCAACGACAGCGACATCTACGGCTCTCCCGGTGCCTTTGCCTCCATCGGAGCCGCT
CAGGTGGGCGTCATGTACCTCCTGATGCCCGTCATCTTCGTCCTCCTCCACCGCAGACCGCGATGGCGCCCCTGG
TGCGGAAGACTAGGCCTCGTCATCACCATGGCCAGCATCTCGGCCTCGGCCTTCGTCTCGACCGTCCACGGCCTC
ATCGCTACTCAGGGGGTCGTGTATGCTCTCGGCTGCGCGCTGCTCTTTAGCCCCGTCTCCGTCTATATGGATGAG
TGGTTCGTTCGCTCCAAGGGGGCGGCTTACGGTGTCATGTGGGGAGGGAAGTCGGCTGTTGGTGTCGGCATGCCC
TTTGTTTTCAACGCCATGCTGAGCCGCTTCGGCTTGAGCATCACGCTTCTCTCCTGGGCTGTTGCTTCGGCTCTC
TTGTCGCTGCCGGCTCTCCTTCTCATGAAGCCCCGGTTACCTCTACCCGCTTCTGGCGACGCCCGTGGCTCCAGG
CCGCTGTCCTGGCGCTTCTTCCGCTGCACAACCTTCTGGATGATGCAGTTGGGCGTCGTGATACAATCGCTGGGC
TACATGATGCCCTCTACGTATCTGGCCAGCTACGCCTTGGCCATCGGCTTGCCCTCGGTCACGGGGCCGCTGCTC
CTGGCCGCCTTCTCGTTGGCTTCGGTGCCCGGTTCCATAATCCACGGGTTCGTCGGCGACAAGGTGTCTGCCAGC
AAGGCCATCTTGGTGTCTTCGTTCGGAAGCGCCCTCCCAGTCTTTCTGCTCTGGGGTCTCAGCCTTCACTTTGCG
AATGTCATGGCTTTTGCACTAGCTTTTGGCTTCTTCGCCGGACGGACTCCCCTACATGAAGCCAACGATAGCAAG
AATCCAACAACACAGATGAGACCCTTTCAAGCCTTCACCAGTGCTCTGGTCGCCAGCACGGCCGCCGTTGCGGCT
GACACGATGCTGGGCTTCGACGCTTCGAGCGTTCATGGCGCCGTCGACTTTGGTCAGGCCTACGCTGATGGAGCT
CGCTTCGCCATCATGAGGACGACGGGAGGTTCTAGCCACGTGGATCGTGCATTCGGGCAATTCCAGCAACAAGCC
GCAGACGCAGGCCTGATCCGCGGAGGCTACCACGTCGGCCAGCCGGAGAGGGCCTTTGGCGGCATCCAGGCCAAG
TACTTTCTCCAGAACGGCGGCGGCTGGATTGACGACGGGAAGACGCTGCCCGGAATGATCATGTTGACGGATAGA
GACCACCGGGAGGCGCGAACCTGCCACGGCATGACGCCCAAGGAGATTCAGCGCTGGATCATCGAGTTCACCGAG
GTCTACCGCGCTTCGACGAGCATCTACCCCATGTTATACACGACTACGGGATGGTGGAAGCAGTGCACTGGCAAC
ACGGTCAATCTCATGAACCGCGCTCTGTTAGTCGTCTCGGATCACGGTGAGAGGCTCGGTGAGCTGCCGGCGGGG
TGGAAGAAGCACACTTTCTGGGAGTATTCGGCCGATTCTCCTTGGGCGGGCAGATCTTATGTCTTTAACGGCGAT
GAGTCGGGGCTTAACAGGACGGCTCTGGTTGGGCGTCCGGAGTAA
Gene >Ophcf2|02546
ATGCCTGTTGCTGTTGACGACCAGAGTTTCGAAGCCGACGACGATGCACAGCTTCTACCGCCTACAGACACCGGA
AGAGGGGCCTACGTGGCTCTCGCGTGCTGCACCGTCTCCCAAGCTCCCATCTGGGGTGAGCTCCTCTAGCAATAG
CATATATACACCAGACATCCCTCCCATCCCCCCCCCCCTTGTTGACTCGCACGCCAGGATACTCGGTCTCGTTCG
GCATCTTCCAAGAATACTACAGCAACGACAGCGACATCTACGGCTCTCCCGGTGCCTTTGCCTCCATCGGAGCCG
CTCAGGTGGGCGTCATGTACCTCCTGATGCCCGTCATCTTCGTCCTCCTCCACCGCAGACCGCGATGGCGCCCCT
GGTGCGGAAGACTAGGCCTCGTCATCACCATGGCCAGCATCTCGGCCTCGGCCTTCGTCTCGACCGTCCACGGCC
TCATCGCTACTCAGGGGGTCGTGTATGCTCTCGGCTGCGCGCTGCTCTTTAGCCCCGTCTCCGTCTATATGGATG
AGTGGTTCGTTCGCTCCAAGGGGGCGGCTTACGGTGTCATGTGGGGAGGGAAGTCGGCTGTTGGTGTCGGCATGC
CCTTTGTTTTCAACGCCATGCTGAGCCGCTTCGGCTTGAGCATCACGCTTCTCTCCTGGGCTGTTGCTTCGGCTC
TCTTGTCGCTGCCGGCTCTCCTTCTCATGAAGCCCCGGTTACCTCTACCCGCTTCTGGCGACGCCCGTGGCTCCA
GGCCGCTGTCCTGGCGCTTCTTCCGCTGCACAACCTTCTGGATGATGCAGTTGGGCGTCGTGATACAATCGCTGG
GCTACATGATGCCCTCTACGTATCTGGCCAGCTACGCCTTGGCCATCGGCTTGCCCTCGGTCACGGGGCCGCTGC
TCCTGGCCGCCTTCTCGTTGGCTTCGGTGCCCGGTTCCATAATCCACGGGTTCGTCGGCGACAAGGTGTCTGCCA
GCAAGGCCATCTTGGTGTCTTCGTTCGGAAGCGCCCTCCCAGTCTTTCTGCTCTGGGGTCTCAGCCTTCACTTTG
CGAATGTCATGGCTTTTGCACTAGCTTTTGGCTTCTTCGCCGGTAAGTTCACAGTTACGAAGCCACCCCCTTTTA
GCTACATGTGTCCATCGTGCTGATGCTTCTCGGAAAGGGGGTTTCAGCTCAACCTGGTCGGGAATGGTCAGTGAG
ATACAGAAAGTCGACGCCAGTGCCGAATCGTCCATCGTCTTTGGCATGCTTCTCGGCGGTCGAGGATTGGGCTTT
GTTTTGAGCGGTCCTGTTAGCGGAGCTCTGCTTTCAAGTCGGACGAGGCTGATGAAGGGAACCCTGGGATACGCC
ACCATTTATGGACCGATGATCATCTTTACCGGCATCACGGCAGTCTTGGGTGCCTGGGGGGCTTATTGTGTTATC
GTTGAGGCGAAGATGCTGCCTTGGTGCGCTCGTCGAGACGCACGGCGTCTGGAGGATCATCTCGAACCCGAGAGA
TGGGCGTGACTGAGTCAAACGCTTCGATATCGATCGATCAGTGTGCAGCAGATATCATATTAAATAGGGCAAGAT
ACAAGGAGACACATGACCTGTATCAGCCCAATGGCTCTGGATGAGATGTGCCCGCATCCTAAAATTAGAAGCACC
TGTCTGGACAACTGGATCGTCTCAAAGGCGTCTTCTGTCTACTGGTTAGATCCCGAAAGCCGGTGGGCTGTCAGT
GTCACTAATCGAAGGCCCGTCACCCCGGCCGAGACACAGCCCTCTTCTTCTCCCGTGAATTCGCTATTTCAGTCC
GAGCTGCTGTGCTTACCCGAAACAGAGTCCGGGCGATAGCATTCCAGCCAGACAAGCAAACTGAGACAGTGTTCT
AAACCCACCGCCAAAACCGCAGTCGGTATTCGCAAATGAAGTTTCTGAGCATAGCCCCATGTCCCGCTCTTGACG
GCGTAGTAACGGCGGTGTCGAGGCCCGAGTCTCGCCTGTTGCGATCCCTCGCTTTGGCCTAGATCAGCAGCTGAC
TGGGGTTTAATAAGGGTCTGGCGAGCAGGACGGACTCCCCTACATGAAGCCAACGATAGCAAGAATCCAACAACA
CAGATGAGACCCTTTCAAGCCTTCACCAGTGCTCTGGTCGCCAGCACGGCCGCCGTTGCGGCTGACACGATGCTG
GGCTTCGACGCTTCGAGCGTTCATGGCGCCGTCGACTTTGGTCAGGCCTACGCTGATGGAGCTCGCTTCGCCATC
ATGAGGGTCAGCTTTGCCAGATACTCCTCATGCATTTGTACGACTTCAGGCTAATCAAGACGAGTGAAGACGACG
GGAGGTTCTAGCCACGTGGATCGTGCATTCGGGCAATTCCAGCAACAAGCCGCAGACGCAGGCCTGATCCGCGGA
GGCTACCACGTCGGCCAGCCGGAGAGGGCCTTTGGCGGCATCCAGGCCAAGTACTTTCTCCAGAACGGCGGCGGC
TGGATTGACGACGGGAAGACGCTGCCCGGAATGATCATGTTGACGGATAGAGACCACCGGGAGGCGCGAACCTGC
CACGGCATGACGCCCAAGGAGATTCAGCGCTGGATCATCGAGTTCACCGAGGTCTACCGCGCTTCGACGAGCATC
TACCCCATGTTATACACGACTACGGGATGGTGGAAGCAGTGCACTGGCAACACGGTCAATCTCATGAACCGCGCT
CTGTTAGTCGTCTCGGATCACGGTGAGAGGCTCGGTGAGCTGCCGGCGGGGTGGAAGAAGCACACTTTCTGGGAG
TATTCGGCCGATTCTCCTTGGGCGGGCAGATCTTATGTCTTTAACGGCGATGAGTCGGGGCTTAACAGGACGGCT
CTGGTTGGGCGTCCGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail