Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02545
Gene name
Locationscaffold_02:4048744..4050883
Strand+
Gene length (bp)2139
Transcript length (bp)2139
Coding sequence length (bp)2139
Protein length (aa) 713

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.6E-21 170 331

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.122 0.1092 0.9298 0.0789 0.079 0.0708 0.314 0.3065 0.1131 0.0241

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH20 1.8E-49 163 498

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2173
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5053
Ophiocordyceps australis map64 (Brazil) OphauB2|7451
Ophiocordyceps camponoti-floridani Ophcf2|02545 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3599
Ophiocordyceps kimflemingae Ophio5|973
Ophiocordyceps subramaniannii Hirsu2|269

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02545
MKLQAGLLPPLLPTIVSGLSSIPSVPYNPSGIGFFPLSEARVIGVDSRYASARDGLGSTLIPPSLLDFAVTFSRD
VEAVLGFRIPVSQQGRGREKGVFLTIDDDASAYTDIVGRPTSEGYSLTVNSSGIFIAGASPLGIWWATRTVLHQG
LLHGRIPHGRGRDSPAWRERGMMLDAGRHFYPTGFLQELCAYMSFFKQNILHLHLSDNLYNNHKIYTRQQSLRLG
AWFRLRSDAQELRGLSSNRNESYARSEMEDLQLACASRGVTVVPELEAPGHALPIVQWRPQLGLSKDLSQLNISH
PETMPTVKMIWRHFLPWFHSKVVSIGADEYAGPVEDYVSFVNSMNVFIQEESNRTKAVRIWGTFPPSRKAGFVNV
HDDVSIQHWSYHEDNPYHDFIRKGYSVVNSIDDFYVVSKWGSNYPNTLDPARTFDGDPDGQEPWYPHIFNMRKAS
DNARRDEPRVIGAITPLWNDYGPNASVYSEAYYAWRRGLPALADKQWGGRLTSRQFDRLFTDLYPHAPAQNLERR
IPSKGDVIFEYDLGVKRSSYDTVKDLSPNGYDATTDCMSKGSSLRMTPRCQLVTPWKSKGRDYTLTVKLVIEAMT
DPGNTKLIVGADSVLMLTPTITLLASGTYHRLKLTMPLGEWVELSLRGRGNQTFVSLERMRDRVAIGEEEFRVVM
GINGERLRSDMVAIEAPVEKVTGWRGQLRGMRLTRRA*
Coding >Ophcf2|02545
ATGAAGCTACAAGCCGGGCTGCTACCACCGCTGCTGCCGACCATCGTCTCCGGCCTCTCCAGCATCCCGTCAGTG
CCGTATAACCCGTCTGGAATCGGCTTCTTCCCGCTATCAGAGGCTCGGGTCATTGGCGTGGATAGTCGGTACGCT
TCGGCGAGGGATGGGCTCGGGTCGACGCTTATCCCCCCTTCGTTGCTCGACTTTGCCGTCACATTCAGCCGCGAT
GTCGAGGCCGTCTTGGGCTTTCGGATCCCCGTCAGCCAGCAAGGTAGAGGCCGGGAAAAGGGCGTCTTCCTCACC
ATCGATGACGATGCTTCGGCTTACACCGACATTGTCGGCCGACCAACCTCGGAGGGATACTCCCTGACCGTCAAC
TCATCCGGCATCTTCATCGCCGGCGCCAGCCCTCTCGGCATCTGGTGGGCCACCCGGACCGTCCTCCATCAGGGC
CTTCTCCACGGCCGAATCCCTCACGGCCGGGGCCGAGACTCGCCGGCCTGGCGAGAAAGAGGCATGATGCTCGAC
GCCGGCCGGCACTTTTACCCGACGGGGTTTCTACAGGAGCTGTGCGCGTACATGTCATTCTTCAAGCAGAACATC
CTACACCTGCATCTCAGCGATAACCTATACAACAACCACAAGATTTACACGCGCCAACAGTCGCTGCGACTCGGC
GCCTGGTTCCGCCTCCGATCCGACGCCCAAGAGCTACGAGGCCTGAGCTCCAACCGCAACGAGTCGTACGCTCGC
TCTGAAATGGAGGACCTCCAGCTGGCTTGTGCTTCCCGGGGCGTCACCGTCGTGCCGGAGTTGGAGGCTCCGGGC
CATGCGCTCCCCATTGTCCAGTGGCGGCCTCAGCTGGGTCTCAGCAAGGATCTGAGCCAGCTAAACATTTCGCAT
CCGGAGACGATGCCGACCGTCAAGATGATATGGCGTCATTTCTTGCCCTGGTTTCACTCAAAGGTCGTCTCCATC
GGGGCCGATGAGTATGCGGGTCCGGTCGAAGACTACGTCAGTTTCGTCAACTCGATGAATGTCTTTATCCAGGAA
GAGTCCAACAGAACCAAGGCGGTGCGTATCTGGGGAACCTTTCCTCCGAGTAGGAAAGCGGGCTTCGTCAACGTA
CATGACGACGTCTCGATCCAACACTGGAGTTACCACGAAGACAACCCCTATCACGACTTCATCCGCAAGGGCTAC
TCCGTCGTCAACTCCATCGACGACTTCTACGTCGTCAGCAAATGGGGCAGCAACTACCCCAACACGCTCGATCCT
GCCAGGACCTTTGACGGCGATCCGGATGGCCAGGAGCCGTGGTATCCCCACATCTTCAACATGCGCAAGGCGTCC
GACAACGCACGACGTGACGAGCCCCGCGTCATCGGCGCCATCACGCCCCTCTGGAACGACTACGGACCGAACGCC
AGTGTCTACTCGGAGGCGTATTACGCCTGGCGTCGAGGCTTGCCCGCCCTGGCCGACAAGCAATGGGGCGGCCGG
TTGACGTCGAGGCAGTTCGATCGCCTCTTCACCGACCTCTATCCGCACGCACCGGCTCAGAACCTGGAGAGAAGG
ATACCGTCCAAGGGGGATGTCATCTTCGAGTACGACCTCGGCGTCAAGCGCTCGAGCTATGATACCGTCAAGGAT
CTCTCACCCAATGGCTACGACGCCACCACCGACTGCATGTCCAAGGGGTCATCTCTGCGAATGACGCCGAGATGC
CAGCTGGTGACGCCCTGGAAATCCAAGGGAAGAGACTACACCTTGACCGTGAAGCTCGTAATCGAAGCCATGACC
GATCCGGGAAACACGAAGCTCATCGTCGGCGCAGACTCGGTCCTGATGCTCACGCCCACCATCACCCTATTGGCA
TCCGGGACCTACCACCGCCTCAAACTTACCATGCCCTTGGGCGAATGGGTAGAGCTGAGCCTACGAGGCCGCGGG
AACCAGACGTTCGTCTCGCTCGAGCGTATGAGGGACAGGGTCGCGATTGGAGAGGAAGAGTTTCGCGTCGTGATG
GGCATCAACGGTGAGCGCCTTCGCTCGGACATGGTGGCTATAGAGGCTCCCGTAGAAAAGGTGACGGGATGGAGA
GGCCAGTTGCGAGGCATGCGGTTGACGCGGAGGGCGTAG
Transcript >Ophcf2|02545
ATGAAGCTACAAGCCGGGCTGCTACCACCGCTGCTGCCGACCATCGTCTCCGGCCTCTCCAGCATCCCGTCAGTG
CCGTATAACCCGTCTGGAATCGGCTTCTTCCCGCTATCAGAGGCTCGGGTCATTGGCGTGGATAGTCGGTACGCT
TCGGCGAGGGATGGGCTCGGGTCGACGCTTATCCCCCCTTCGTTGCTCGACTTTGCCGTCACATTCAGCCGCGAT
GTCGAGGCCGTCTTGGGCTTTCGGATCCCCGTCAGCCAGCAAGGTAGAGGCCGGGAAAAGGGCGTCTTCCTCACC
ATCGATGACGATGCTTCGGCTTACACCGACATTGTCGGCCGACCAACCTCGGAGGGATACTCCCTGACCGTCAAC
TCATCCGGCATCTTCATCGCCGGCGCCAGCCCTCTCGGCATCTGGTGGGCCACCCGGACCGTCCTCCATCAGGGC
CTTCTCCACGGCCGAATCCCTCACGGCCGGGGCCGAGACTCGCCGGCCTGGCGAGAAAGAGGCATGATGCTCGAC
GCCGGCCGGCACTTTTACCCGACGGGGTTTCTACAGGAGCTGTGCGCGTACATGTCATTCTTCAAGCAGAACATC
CTACACCTGCATCTCAGCGATAACCTATACAACAACCACAAGATTTACACGCGCCAACAGTCGCTGCGACTCGGC
GCCTGGTTCCGCCTCCGATCCGACGCCCAAGAGCTACGAGGCCTGAGCTCCAACCGCAACGAGTCGTACGCTCGC
TCTGAAATGGAGGACCTCCAGCTGGCTTGTGCTTCCCGGGGCGTCACCGTCGTGCCGGAGTTGGAGGCTCCGGGC
CATGCGCTCCCCATTGTCCAGTGGCGGCCTCAGCTGGGTCTCAGCAAGGATCTGAGCCAGCTAAACATTTCGCAT
CCGGAGACGATGCCGACCGTCAAGATGATATGGCGTCATTTCTTGCCCTGGTTTCACTCAAAGGTCGTCTCCATC
GGGGCCGATGAGTATGCGGGTCCGGTCGAAGACTACGTCAGTTTCGTCAACTCGATGAATGTCTTTATCCAGGAA
GAGTCCAACAGAACCAAGGCGGTGCGTATCTGGGGAACCTTTCCTCCGAGTAGGAAAGCGGGCTTCGTCAACGTA
CATGACGACGTCTCGATCCAACACTGGAGTTACCACGAAGACAACCCCTATCACGACTTCATCCGCAAGGGCTAC
TCCGTCGTCAACTCCATCGACGACTTCTACGTCGTCAGCAAATGGGGCAGCAACTACCCCAACACGCTCGATCCT
GCCAGGACCTTTGACGGCGATCCGGATGGCCAGGAGCCGTGGTATCCCCACATCTTCAACATGCGCAAGGCGTCC
GACAACGCACGACGTGACGAGCCCCGCGTCATCGGCGCCATCACGCCCCTCTGGAACGACTACGGACCGAACGCC
AGTGTCTACTCGGAGGCGTATTACGCCTGGCGTCGAGGCTTGCCCGCCCTGGCCGACAAGCAATGGGGCGGCCGG
TTGACGTCGAGGCAGTTCGATCGCCTCTTCACCGACCTCTATCCGCACGCACCGGCTCAGAACCTGGAGAGAAGG
ATACCGTCCAAGGGGGATGTCATCTTCGAGTACGACCTCGGCGTCAAGCGCTCGAGCTATGATACCGTCAAGGAT
CTCTCACCCAATGGCTACGACGCCACCACCGACTGCATGTCCAAGGGGTCATCTCTGCGAATGACGCCGAGATGC
CAGCTGGTGACGCCCTGGAAATCCAAGGGAAGAGACTACACCTTGACCGTGAAGCTCGTAATCGAAGCCATGACC
GATCCGGGAAACACGAAGCTCATCGTCGGCGCAGACTCGGTCCTGATGCTCACGCCCACCATCACCCTATTGGCA
TCCGGGACCTACCACCGCCTCAAACTTACCATGCCCTTGGGCGAATGGGTAGAGCTGAGCCTACGAGGCCGCGGG
AACCAGACGTTCGTCTCGCTCGAGCGTATGAGGGACAGGGTCGCGATTGGAGAGGAAGAGTTTCGCGTCGTGATG
GGCATCAACGGTGAGCGCCTTCGCTCGGACATGGTGGCTATAGAGGCTCCCGTAGAAAAGGTGACGGGATGGAGA
GGCCAGTTGCGAGGCATGCGGTTGACGCGGAGGGCGTAG
Gene >Ophcf2|02545
ATGAAGCTACAAGCCGGGCTGCTACCACCGCTGCTGCCGACCATCGTCTCCGGCCTCTCCAGCATCCCGTCAGTG
CCGTATAACCCGTCTGGAATCGGCTTCTTCCCGCTATCAGAGGCTCGGGTCATTGGCGTGGATAGTCGGTACGCT
TCGGCGAGGGATGGGCTCGGGTCGACGCTTATCCCCCCTTCGTTGCTCGACTTTGCCGTCACATTCAGCCGCGAT
GTCGAGGCCGTCTTGGGCTTTCGGATCCCCGTCAGCCAGCAAGGTAGAGGCCGGGAAAAGGGCGTCTTCCTCACC
ATCGATGACGATGCTTCGGCTTACACCGACATTGTCGGCCGACCAACCTCGGAGGGATACTCCCTGACCGTCAAC
TCATCCGGCATCTTCATCGCCGGCGCCAGCCCTCTCGGCATCTGGTGGGCCACCCGGACCGTCCTCCATCAGGGC
CTTCTCCACGGCCGAATCCCTCACGGCCGGGGCCGAGACTCGCCGGCCTGGCGAGAAAGAGGCATGATGCTCGAC
GCCGGCCGGCACTTTTACCCGACGGGGTTTCTACAGGAGCTGTGCGCGTACATGTCATTCTTCAAGCAGAACATC
CTACACCTGCATCTCAGCGATAACCTATACAACAACCACAAGATTTACACGCGCCAACAGTCGCTGCGACTCGGC
GCCTGGTTCCGCCTCCGATCCGACGCCCAAGAGCTACGAGGCCTGAGCTCCAACCGCAACGAGTCGTACGCTCGC
TCTGAAATGGAGGACCTCCAGCTGGCTTGTGCTTCCCGGGGCGTCACCGTCGTGCCGGAGTTGGAGGCTCCGGGC
CATGCGCTCCCCATTGTCCAGTGGCGGCCTCAGCTGGGTCTCAGCAAGGATCTGAGCCAGCTAAACATTTCGCAT
CCGGAGACGATGCCGACCGTCAAGATGATATGGCGTCATTTCTTGCCCTGGTTTCACTCAAAGGTCGTCTCCATC
GGGGCCGATGAGTATGCGGGTCCGGTCGAAGACTACGTCAGTTTCGTCAACTCGATGAATGTCTTTATCCAGGAA
GAGTCCAACAGAACCAAGGCGGTGCGTATCTGGGGAACCTTTCCTCCGAGTAGGAAAGCGGGCTTCGTCAACGTA
CATGACGACGTCTCGATCCAACACTGGAGTTACCACGAAGACAACCCCTATCACGACTTCATCCGCAAGGGCTAC
TCCGTCGTCAACTCCATCGACGACTTCTACGTCGTCAGCAAATGGGGCAGCAACTACCCCAACACGCTCGATCCT
GCCAGGACCTTTGACGGCGATCCGGATGGCCAGGAGCCGTGGTATCCCCACATCTTCAACATGCGCAAGGCGTCC
GACAACGCACGACGTGACGAGCCCCGCGTCATCGGCGCCATCACGCCCCTCTGGAACGACTACGGACCGAACGCC
AGTGTCTACTCGGAGGCGTATTACGCCTGGCGTCGAGGCTTGCCCGCCCTGGCCGACAAGCAATGGGGCGGCCGG
TTGACGTCGAGGCAGTTCGATCGCCTCTTCACCGACCTCTATCCGCACGCACCGGCTCAGAACCTGGAGAGAAGG
ATACCGTCCAAGGGGGATGTCATCTTCGAGTACGACCTCGGCGTCAAGCGCTCGAGCTATGATACCGTCAAGGAT
CTCTCACCCAATGGCTACGACGCCACCACCGACTGCATGTCCAAGGGGTCATCTCTGCGAATGACGCCGAGATGC
CAGCTGGTGACGCCCTGGAAATCCAAGGGAAGAGACTACACCTTGACCGTGAAGCTCGTAATCGAAGCCATGACC
GATCCGGGAAACACGAAGCTCATCGTCGGCGCAGACTCGGTCCTGATGCTCACGCCCACCATCACCCTATTGGCA
TCCGGGACCTACCACCGCCTCAAACTTACCATGCCCTTGGGCGAATGGGTAGAGCTGAGCCTACGAGGCCGCGGG
AACCAGACGTTCGTCTCGCTCGAGCGTATGAGGGACAGGGTCGCGATTGGAGAGGAAGAGTTTCGCGTCGTGATG
GGCATCAACGGTGAGCGCCTTCGCTCGGACATGGTGGCTATAGAGGCTCCCGTAGAAAAGGTGACGGGATGGAGA
GGCCAGTTGCGAGGCATGCGGTTGACGCGGAGGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail