Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02543
Gene name
Locationscaffold_02:4043833..4045433
Strand-
Gene length (bp)1600
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 3.3E-146 36 412

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 447 469 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 93.39 53.10 133.69
Alive In ants, during behavior modification 114.36 63.91 164.80
Dead In ants, recently dead 91.21 51.57 130.84

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.326806 no
Alive Dead 0.183304 no
Dead Fungus 0.924683 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02543
MAWSSRMRRLLLAGGLLLRVAVGAQSPYKIDTPDAIRESARTLAYDMMLFYVGNHSGGIPGILPGPPPAGDYYWW
EGGAMMGTYIDYWRWTGDSSYNHVVMEGMLHQVGENENYMPANHTLSLGNDDQGFWGMSAMLAAENRFPNPPDDK
PQWLALAQAVWNTMASPERHDDTCGGGLRWQIPFSNSGYGYKNTIANACFFNIGSRLARYTGNSSYAEWAEKTWD
WLWALKYIDHESYRVYDGGHVNKNCTDVNTATFSYNAAALLQGAAYMYNFTRGEKKWEERVRKLTESTLPYFFPK
GIAYETECEPRVRKSCTPDMITYKGYTHRWLAVVTQIAPFTRHLIMPVLRSSTEAAIKQCTGGASGRTCGFYWSS
GNFVDPAKDKTSGAGEAMNVLAAVSSLLVEYAEPPVSHDSGGISKGNPGAGGGGSFNGEKPLRPITTADRAGAGI
VTFLMLGGTIAAFIWMSVFE*
Coding >Ophcf2|02543
ATGGCCTGGTCGTCGAGGATGCGGCGCCTGTTGCTAGCCGGCGGCCTGCTGCTCCGGGTCGCGGTCGGGGCACAG
TCGCCGTACAAGATCGACACGCCCGACGCCATCCGCGAATCGGCCCGGACGCTGGCCTACGACATGATGCTCTTC
TACGTCGGGAACCACTCGGGCGGCATCCCCGGCATCCTCCCCGGTCCCCCTCCGGCCGGCGACTACTACTGGTGG
GAGGGCGGCGCCATGATGGGCACCTACATCGACTACTGGCGCTGGACCGGCGACTCGAGCTATAACCATGTCGTC
ATGGAGGGTATGCTGCATCAGGTGGGCGAGAATGAGAACTACATGCCGGCCAACCACACTCTCTCGCTCGGCAAC
GACGATCAGGGCTTCTGGGGCATGTCGGCCATGCTGGCAGCCGAGAACAGGTTCCCTAACCCGCCGGACGATAAG
CCTCAGTGGCTAGCCCTGGCACAGGCCGTCTGGAACACCATGGCCAGTCCGGAGCGGCACGACGACACGTGCGGC
GGCGGCCTCCGCTGGCAGATTCCCTTTTCCAACTCTGGGTACGGCTATAAGAATACCATCGCCAACGCATGCTTC
TTCAACATCGGCTCCCGTCTTGCTCGCTACACGGGTAACAGCAGCTACGCCGAATGGGCGGAGAAGACGTGGGAC
TGGCTCTGGGCCCTCAAGTACATCGATCACGAAAGCTACCGCGTCTATGACGGCGGTCACGTCAACAAGAACTGC
ACCGACGTCAACACCGCCACCTTTTCCTACAACGCCGCCGCTCTGCTACAGGGCGCGGCTTACATGTACAACTTT
ACTCGAGGCGAGAAGAAGTGGGAAGAGCGCGTCCGCAAGCTGACGGAGAGCACGCTTCCCTACTTCTTCCCCAAG
GGCATCGCCTACGAGACCGAGTGCGAGCCGCGCGTAAGAAAGTCTTGCACGCCAGACATGATCACCTACAAGGGT
TACACACACCGCTGGCTTGCTGTCGTCACCCAGATCGCGCCCTTTACGCGACATCTCATCATGCCCGTCCTGCGC
TCCTCTACCGAGGCTGCCATCAAGCAGTGCACTGGCGGCGCCTCCGGACGCACTTGTGGCTTCTACTGGTCCAGC
GGCAACTTCGTCGACCCGGCCAAGGACAAGACGAGCGGCGCCGGCGAAGCCATGAATGTCTTGGCCGCCGTCTCG
AGCCTGTTGGTGGAATACGCTGAGCCACCTGTGTCGCACGATTCCGGCGGCATCTCCAAAGGAAACCCCGGAGCT
GGAGGCGGCGGCTCCTTCAACGGCGAGAAGCCATTGAGGCCCATCACCACCGCAGATCGAGCAGGGGCCGGCATC
GTCACCTTTTTGATGCTGGGCGGTACCATCGCCGCCTTTATCTGGATGAGCGTCTTCGAGTAG
Transcript >Ophcf2|02543
ATGGCCTGGTCGTCGAGGATGCGGCGCCTGTTGCTAGCCGGCGGCCTGCTGCTCCGGGTCGCGGTCGGGGCACAG
TCGCCGTACAAGATCGACACGCCCGACGCCATCCGCGAATCGGCCCGGACGCTGGCCTACGACATGATGCTCTTC
TACGTCGGGAACCACTCGGGCGGCATCCCCGGCATCCTCCCCGGTCCCCCTCCGGCCGGCGACTACTACTGGTGG
GAGGGCGGCGCCATGATGGGCACCTACATCGACTACTGGCGCTGGACCGGCGACTCGAGCTATAACCATGTCGTC
ATGGAGGGTATGCTGCATCAGGTGGGCGAGAATGAGAACTACATGCCGGCCAACCACACTCTCTCGCTCGGCAAC
GACGATCAGGGCTTCTGGGGCATGTCGGCCATGCTGGCAGCCGAGAACAGGTTCCCTAACCCGCCGGACGATAAG
CCTCAGTGGCTAGCCCTGGCACAGGCCGTCTGGAACACCATGGCCAGTCCGGAGCGGCACGACGACACGTGCGGC
GGCGGCCTCCGCTGGCAGATTCCCTTTTCCAACTCTGGGTACGGCTATAAGAATACCATCGCCAACGCATGCTTC
TTCAACATCGGCTCCCGTCTTGCTCGCTACACGGGTAACAGCAGCTACGCCGAATGGGCGGAGAAGACGTGGGAC
TGGCTCTGGGCCCTCAAGTACATCGATCACGAAAGCTACCGCGTCTATGACGGCGGTCACGTCAACAAGAACTGC
ACCGACGTCAACACCGCCACCTTTTCCTACAACGCCGCCGCTCTGCTACAGGGCGCGGCTTACATGTACAACTTT
ACTCGAGGCGAGAAGAAGTGGGAAGAGCGCGTCCGCAAGCTGACGGAGAGCACGCTTCCCTACTTCTTCCCCAAG
GGCATCGCCTACGAGACCGAGTGCGAGCCGCGCGTAAGAAAGTCTTGCACGCCAGACATGATCACCTACAAGGGT
TACACACACCGCTGGCTTGCTGTCGTCACCCAGATCGCGCCCTTTACGCGACATCTCATCATGCCCGTCCTGCGC
TCCTCTACCGAGGCTGCCATCAAGCAGTGCACTGGCGGCGCCTCCGGACGCACTTGTGGCTTCTACTGGTCCAGC
GGCAACTTCGTCGACCCGGCCAAGGACAAGACGAGCGGCGCCGGCGAAGCCATGAATGTCTTGGCCGCCGTCTCG
AGCCTGTTGGTGGAATACGCTGAGCCACCTGTGTCGCACGATTCCGGCGGCATCTCCAAAGGAAACCCCGGAGCT
GGAGGCGGCGGCTCCTTCAACGGCGAGAAGCCATTGAGGCCCATCACCACCGCAGATCGAGCAGGGGCCGGCATC
GTCACCTTTTTGATGCTGGGCGGTACCATCGCCGCCTTTATCTGGATGAGCGTCTTCGAGTAG
Gene >Ophcf2|02543
ATGGCCTGGTCGTCGAGGATGCGGCGCCTGTTGCTAGCCGGCGGCCTGCTGCTCCGGGTCGCGGTCGGGGCACAG
TCGCCGTACAAGATCGACACGCCCGGTAGGTATCGATTCATCTGGCAAAGCCAGCTCGTGGACTGACAGCGCAAG
ACGCCATCCGCGAATCGGCCCGGACGCTGGCCTACGACATGATGCTCTTCTACGTCGGGAACCACTCGGGCGGCA
TCCCCGGCATCCTCCCCGGTCCCCCTCCGGCCGGCGACTACTACTGGTGGGAGGGCGGCGCCATGATGGGCACCT
ACATCGACTACTGGCGCTGGACCGGCGACTCGAGCTATAACCATGTCGTCATGGAGGGTATGCTGCATCAGGTGG
GCGAGAATGAGAACTACATGCCGGCCAACCACACTCTCTCGCTCGGCAACGACGATCAGGGCTTCTGGGGCATGT
CGGCCATGCTGGCAGCCGAGAACAGGTTCCCTAACCCGCCGGACGATAAGCCTCAGTGGCTAGCCCTGGCACAGG
CCGTCTGGAACACCATGGCCAGTCCGGAGCGGCACGACGACACGTGCGGCGGCGGCCTCCGCTGGCAGATTCCCT
TTTCCAACTCTGGGTACGGCTATAAGAATAGTGCGTTGTCTCCCCTTCCCCGGGTGGTGTATCGTTCTGTGTCTG
TTGTTGGTAGGCCGCTGACGCCATCGACGGTAGCCATCGCCAACGCATGCTTCTTCAACATCGGCTCCCGTCTTG
CTCGCTACACGGGTAACAGCAGCTACGCCGAATGGGCGGAGAAGACGTGGGACTGGCTCTGGGCCCTCAAGTACA
TCGATCACGAAAGCTACCGCGTCTATGACGGCGGTCACGTCAACAAGAACTGCACCGACGTCAACACCGCCACCT
TTTCCTACAACGCCGCCGCTCTGCTACAGGGCGCGGCTTACATGTACAACTTTGTGAGTTCCTGGCCTTTCCCAT
TGTCTGGTCTTATGGTTCCTCGACTCACAACCTACAGACTCGAGGCGAGAAGAAGTGGGAAGAGCGCGTCCGCAA
GCTGACGGAGAGCACGCTTCCCTACTTCTTCCCCAAGGGCATCGCCTACGAGACCGAGTGCGAGCCGCGCGTAAG
AAAGTCTTGCACGCCAGACATGATCACCTACAAGGGTTACACACACCGCTGGCTTGCTGTCGTCACCCAGATCGC
GCCCTTTACGCGACATCTCATCATGCCCGTCCTGCGCTCCTCTACCGAGGCTGCCATCAAGCAGTGCACTGGCGG
CGCCTCCGGACGCACTTGTGGCTTCTACTGGTCCAGCGGCAACTTCGTCGACCCGGCCAAGGACAAGACGAGCGG
CGCCGGCGAAGCCATGAATGTCTTGGCCGCCGTCTCGAGCCTGTTGGTGGAATACGCTGAGCCACCTGTGTCGCA
CGATTCCGGCGGCATCTCCAAAGGAAACCCCGGAGCTGGAGGCGGCGGCTCCTTCAACGGCGAGAAGCCATTGAG
GCCCATCACCACCGCAGATCGAGCAGGGGCCGGCATCGTCACCTTTTTGATGCTGGGCGGTACCATCGCCGCCTT
TATCTGGATGAGCGTCTTCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail