Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02542
Gene name
Locationscaffold_02:4041484..4043071
Strand-
Gene length (bp)1587
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 1.1E-08 46 147

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2235 0.9588 0.1501 0.0229 0.087 0.0015 0.0188 0.0118 0.0102 0.01

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2156
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6376
Ophiocordyceps australis map64 (Brazil) OphauB2|7595
Ophiocordyceps camponoti-floridani Ophcf2|02542 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3602
Ophiocordyceps kimflemingae Ophio5|970
Ophiocordyceps subramaniannii Hirsu2|265

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02542
MVRRNSVGELGFFDLEAEESRDSDSNSSGSDSDSNDVSSSSSEPAFSCFTQFPPELRARVWEMFCSDLEVKARVL
PFMVMQNTRYTGNLVASPNVIDQTRPLRCLMAVHHESRGLAKVVFPHTLRFKADYDGKVDASMVFNQRTDLILLE
TPLFRMDCSVPALQTETIWNLAFSIRIFADDESIARGISRLFRNFPNLKRLFHQIDEAAIRTRNIQWVVSERAHQ
VLVETFEEKPGTSNRSCPSRFRVSPRNVALNSCPWDEPHLENHGHYSSEDSSADDDSDESTGTDLDEYESEGIDD
SDLNDDDEEEDSIDAGAVPVQGEHLEDSDEDGPVQADRDPSEARFSSPELDEEQSLKQSERGSFKRKIVIDSDDD
DDGDDDHDDHETRVKRPRLARRIVCDSGDDDDDESVGDGQPSRIRAAPSDVEPSDGRSEQQTSGSSSDDGDSVEE
EDPQDDDEGDGSDEDDLIDDAISEDSAGSSHEEDE*
Coding >Ophcf2|02542
ATGGTCAGGCGCAACAGTGTCGGGGAGTTGGGCTTCTTTGACCTCGAGGCCGAAGAGTCCCGCGACAGCGACTCC
AACTCGAGCGGCAGCGACTCCGACAGCAATGACGTTTCCTCCTCTTCGTCCGAGCCTGCCTTCTCCTGCTTTACG
CAGTTTCCTCCCGAGCTTCGCGCTCGCGTCTGGGAAATGTTCTGCTCTGACCTCGAAGTCAAGGCCCGCGTCTTG
CCATTCATGGTCATGCAAAACACCCGCTATACCGGTAATCTCGTCGCCTCCCCCAACGTTATTGATCAGACGAGG
CCTCTGCGATGTCTCATGGCCGTTCATCACGAGTCGCGCGGCCTAGCCAAGGTCGTCTTCCCCCATACTCTCCGA
TTCAAGGCCGACTACGACGGCAAAGTGGACGCTTCTATGGTATTTAATCAGCGTACCGATCTCATTCTCCTCGAA
ACTCCCCTTTTCCGAATGGACTGCTCCGTACCAGCGCTCCAGACCGAGACTATCTGGAATCTCGCTTTCTCCATT
CGGATATTTGCTGATGACGAGTCCATTGCGAGGGGCATTTCGCGCTTGTTCCGCAATTTTCCCAACCTGAAAAGA
CTCTTCCACCAGATTGACGAAGCGGCTATTCGAACTCGCAATATCCAGTGGGTCGTGTCCGAACGCGCCCATCAA
GTACTGGTCGAGACATTTGAGGAGAAGCCTGGTACCTCAAACCGCTCGTGCCCGTCGAGGTTTCGCGTCTCACCC
AGGAATGTGGCATTAAACTCTTGCCCTTGGGACGAACCCCATCTCGAGAACCATGGTCACTATTCTAGTGAAGAT
AGCAGTGCTGATGACGATTCTGATGAGTCTACCGGGACCGATCTAGACGAGTACGAAAGCGAGGGTATCGACGAT
TCCGATTTAAATGATGACGACGAGGAAGAGGACAGCATCGATGCCGGTGCCGTTCCTGTCCAAGGGGAGCATCTC
GAGGATAGTGACGAGGATGGCCCTGTCCAGGCTGATCGTGACCCTTCCGAAGCGAGGTTTTCGAGCCCCGAGCTG
GATGAGGAGCAATCTCTCAAACAATCCGAACGTGGGTCTTTCAAGCGCAAGATTGTCATCGACTCCGACGACGAT
GATGACGGCGACGATGACCATGACGACCACGAGACTAGGGTCAAGCGTCCCCGCCTGGCTCGCCGTATCGTTTGC
GATTCAGGCGACGATGACGATGACGAATCCGTCGGTGATGGGCAACCGTCTCGCATCCGCGCCGCCCCATCCGAT
GTAGAACCGTCCGATGGCCGCTCGGAGCAGCAGACGTCAGGTAGCTCGTCCGACGACGGCGACTCGGTAGAGGAA
GAAGACCCTCAGGACGATGACGAGGGCGATGGTTCCGACGAGGACGACCTGATTGATGATGCGATTTCTGAGGAC
AGCGCGGGAAGCAGTCACGAAGAGGACGAGTAA
Transcript >Ophcf2|02542
ATGGTCAGGCGCAACAGTGTCGGGGAGTTGGGCTTCTTTGACCTCGAGGCCGAAGAGTCCCGCGACAGCGACTCC
AACTCGAGCGGCAGCGACTCCGACAGCAATGACGTTTCCTCCTCTTCGTCCGAGCCTGCCTTCTCCTGCTTTACG
CAGTTTCCTCCCGAGCTTCGCGCTCGCGTCTGGGAAATGTTCTGCTCTGACCTCGAAGTCAAGGCCCGCGTCTTG
CCATTCATGGTCATGCAAAACACCCGCTATACCGGTAATCTCGTCGCCTCCCCCAACGTTATTGATCAGACGAGG
CCTCTGCGATGTCTCATGGCCGTTCATCACGAGTCGCGCGGCCTAGCCAAGGTCGTCTTCCCCCATACTCTCCGA
TTCAAGGCCGACTACGACGGCAAAGTGGACGCTTCTATGGTATTTAATCAGCGTACCGATCTCATTCTCCTCGAA
ACTCCCCTTTTCCGAATGGACTGCTCCGTACCAGCGCTCCAGACCGAGACTATCTGGAATCTCGCTTTCTCCATT
CGGATATTTGCTGATGACGAGTCCATTGCGAGGGGCATTTCGCGCTTGTTCCGCAATTTTCCCAACCTGAAAAGA
CTCTTCCACCAGATTGACGAAGCGGCTATTCGAACTCGCAATATCCAGTGGGTCGTGTCCGAACGCGCCCATCAA
GTACTGGTCGAGACATTTGAGGAGAAGCCTGGTACCTCAAACCGCTCGTGCCCGTCGAGGTTTCGCGTCTCACCC
AGGAATGTGGCATTAAACTCTTGCCCTTGGGACGAACCCCATCTCGAGAACCATGGTCACTATTCTAGTGAAGAT
AGCAGTGCTGATGACGATTCTGATGAGTCTACCGGGACCGATCTAGACGAGTACGAAAGCGAGGGTATCGACGAT
TCCGATTTAAATGATGACGACGAGGAAGAGGACAGCATCGATGCCGGTGCCGTTCCTGTCCAAGGGGAGCATCTC
GAGGATAGTGACGAGGATGGCCCTGTCCAGGCTGATCGTGACCCTTCCGAAGCGAGGTTTTCGAGCCCCGAGCTG
GATGAGGAGCAATCTCTCAAACAATCCGAACGTGGGTCTTTCAAGCGCAAGATTGTCATCGACTCCGACGACGAT
GATGACGGCGACGATGACCATGACGACCACGAGACTAGGGTCAAGCGTCCCCGCCTGGCTCGCCGTATCGTTTGC
GATTCAGGCGACGATGACGATGACGAATCCGTCGGTGATGGGCAACCGTCTCGCATCCGCGCCGCCCCATCCGAT
GTAGAACCGTCCGATGGCCGCTCGGAGCAGCAGACGTCAGGTAGCTCGTCCGACGACGGCGACTCGGTAGAGGAA
GAAGACCCTCAGGACGATGACGAGGGCGATGGTTCCGACGAGGACGACCTGATTGATGATGCGATTTCTGAGGAC
AGCGCGGGAAGCAGTCACGAAGAGGACGAGTAA
Gene >Ophcf2|02542
ATGGTCAGGCGCAACAGTGTCGGGGAGTTGGGCTTCTTTGACCTCGAGGCCGAAGAGTCCCGCGACAGCGACTCC
AACTCGAGCGGCAGCGACTCCGACAGCAATGACGTTTCCTCCTCTTCGTCCGAGCCTGCCTTCTCCTGCTTTACG
CAGTTTCCTCCCGAGCTTCGCGCTCGCGTCTGGGAAATGTTCTGCTCTGACCTCGAAGTCAAGGCCCGCGTCTTG
CCATTCATGGTCATGCAAAACACCCGCTATACCGGTAATCTCGTCGCCTCCCCCAACGTTATTGATCAGACGAGG
CCTCTGCGATGTCTCATGGCCGTTCATCACGAGTCGCGCGGCCTAGCCAAGGTCGTCTTCCCCCATACTCTCCGA
TTCAAGGCCGACTACGACGGCAAAGTGGACGCTTCTATGGTATTTAATCAGCGTACCGATCTCATTCTCCTCGAA
ACTCCCCTTTTCCGAATGGACTGCTCCGTACCAGCGCTCCAGACCGAGACTATCTGGAATCTCGCTTTCTCCATT
CGGATATTTGCTGATGACGAGTCCATTGCGAGGGGCATTTCGCGCTTGTTCCGCAATTTTCCCAACCTGAAAAGA
CTCTTCCACCAGATTGACGAAGCGGCTATTCGAACTCGCAATATCCAGTGGGTCGTGTCCGAACGCGCCCATCAA
GTACTGGTCGAGACATTTGAGGAGAAGCCTGGTGTAGGTGAAAACACACAGACTGTTTACTGCTGGCCCGACGTC
GACGTGACTCCTGACTTTGCGATGCCGGAAGACCTCAAACCGCTCGTGCCCGTCGAGGTTTCGCGTCTCACCCAG
GAATGTGGCATTAAACTCTTGCCCTTGGTTATGTTTGAGTTTGAGAGCTCCATCGCTCGTTTCTGGCATCTGCTG
AAGAACAGGGACGAACCCCATCTCGAGAACCATGGTCACTATTCTAGTGAAGATAGCAGTGCTGATGACGATTCT
GATGAGTCTACCGGGACCGATCTAGACGAGTACGAAAGCGAGGGTATCGACGATTCCGATTTAAATGATGACGAC
GAGGAAGAGGACAGCATCGATGCCGGTGCCGTTCCTGTCCAAGGGGAGCATCTCGAGGATAGTGACGAGGATGGC
CCTGTCCAGGCTGATCGTGACCCTTCCGAAGCGAGGTTTTCGAGCCCCGAGCTGGATGAGGAGCAATCTCTCAAA
CAATCCGAACGTGGGTCTTTCAAGCGCAAGATTGTCATCGACTCCGACGACGATGATGACGGCGACGATGACCAT
GACGACCACGAGACTAGGGTCAAGCGTCCCCGCCTGGCTCGCCGTATCGTTTGCGATTCAGGCGACGATGACGAT
GACGAATCCGTCGGTGATGGGCAACCGTCTCGCATCCGCGCCGCCCCATCCGATGTAGAACCGTCCGATGGCCGC
TCGGAGCAGCAGACGTCAGGTAGCTCGTCCGACGACGGCGACTCGGTAGAGGAAGAAGACCCTCAGGACGATGAC
GAGGGCGATGGTTCCGACGAGGACGACCTGATTGATGATGCGATTTCTGAGGACAGCGCGGGAAGCAGTCACGAA
GAGGACGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail