Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02539
Gene name
Locationscaffold_02:4033489..4035145
Strand+
Gene length (bp)1656
Transcript length (bp)1602
Coding sequence length (bp)1602
Protein length (aa) 534

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 4.8E-70 32 467

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.1503 0.1023 0.303 0.0271 0.2436 0.0477 0.7743 0.1001 0.204 0.08

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.89 0.00 1.77
Alive In ants, during behavior modification 169.28 83.22 255.34
Dead In ants, recently dead 628.02 199.40 1056.63

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup9
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|490
Ophiocordyceps australis 1348a (Ghana) OphauG2|3573
Ophiocordyceps australis 1348a (Ghana) OphauG2|4985
Ophiocordyceps australis 1348a (Ghana) OphauG2|6472
Ophiocordyceps australis 1348a (Ghana) OphauG2|7423
Ophiocordyceps australis map64 (Brazil) OphauB2|3108
Ophiocordyceps australis map64 (Brazil) OphauB2|5639
Ophiocordyceps australis map64 (Brazil) OphauB2|628
Ophiocordyceps australis map64 (Brazil) OphauB2|6422
Ophiocordyceps australis map64 (Brazil) OphauB2|853
Ophiocordyceps camponoti-floridani Ophcf2|06974
Ophiocordyceps camponoti-floridani Ophcf2|02539 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00830
Ophiocordyceps camponoti-floridani Ophcf2|03223
Ophiocordyceps camponoti-floridani Ophcf2|00829
Ophiocordyceps camponoti-rufipedis Ophun1|3123
Ophiocordyceps camponoti-rufipedis Ophun1|4430
Ophiocordyceps camponoti-rufipedis Ophun1|383
Ophiocordyceps camponoti-rufipedis Ophun1|5525
Ophiocordyceps camponoti-rufipedis Ophun1|2010
Ophiocordyceps camponoti-rufipedis Ophun1|84
Ophiocordyceps camponoti-rufipedis Ophun1|6846
Ophiocordyceps kimflemingae Ophio5|4726
Ophiocordyceps kimflemingae Ophio5|4727
Ophiocordyceps kimflemingae Ophio5|5518
Ophiocordyceps kimflemingae Ophio5|7260
Ophiocordyceps kimflemingae Ophio5|98
Ophiocordyceps kimflemingae Ophio5|4349
Ophiocordyceps kimflemingae Ophio5|3093
Ophiocordyceps kimflemingae Ophio5|4369
Ophiocordyceps subramaniannii Hirsu2|7868
Ophiocordyceps subramaniannii Hirsu2|30
Ophiocordyceps subramaniannii Hirsu2|10608

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02539
MANKLLFQAVGVILAIILYHRYSQTRPAGKLPPGPKPLPLLGNINDLPPKGIPEYQHWLKHMRSYGPLSSITVLG
QTTVIFHDRQAAHELLERTAKKMSGRPRLVFGPKLCGFDRILINKQPDDESFRCHRRLMQTQFGSSSAVAGYHDV
LEAEVKVLLLRIWRQPERTLEILKTVTGSIILRVTYGYAVDQEKKDPLLDIVGRMMEDLSVAFTALAWLVDLIPA
LQYLPSFLPGMGFKKTAEECKKTSLAVEDIPYAFTRRQMESSNSRPSYVSRLLQDSSRDGLGPEEKAANEDDIKC
TACIIFGGGADTTSASLNAFVLAMTLNPEIQRKAQKEIDSLTGSTRLPSFEDRSQLPYIDAIVTETLRWLPVAPM
GTAHMATEDVFYNGYLIPKGAQLVPSIWWFTHDPDVYRDPDSFDPDRYAARNEPDPRATVFGFGRRRCPGMYFAE
ANLFIIVAQMLAVFTIGKVVGEDGKEVEPEIRTTPGLISNVLGFPFTIKARNVELLRAVEAENPGVESDAGLVRE
EIDARMKA*
Coding >Ophcf2|02539
ATGGCGAACAAGTTGCTGTTTCAAGCCGTAGGTGTGATTCTCGCCATCATCCTCTATCATCGATACTCGCAGACA
AGACCGGCTGGAAAGCTCCCACCCGGACCGAAGCCTCTCCCACTCCTCGGCAACATCAACGATCTCCCGCCAAAG
GGGATTCCAGAATACCAGCACTGGCTAAAGCACATGCGGAGCTACGGCCCACTGAGCTCCATCACCGTCCTGGGC
CAAACGACCGTCATCTTCCACGACCGGCAGGCGGCCCACGAGCTCCTGGAGCGGACGGCCAAGAAGATGTCTGGG
AGGCCGCGGCTGGTGTTTGGGCCTAAGCTGTGTGGATTCGACCGCATCCTGATAAATAAGCAACCTGATGACGAG
TCTTTTCGATGTCATCGTCGTCTGATGCAGACGCAGTTTGGGTCCAGTTCTGCTGTGGCGGGCTATCATGATGTT
CTGGAGGCTGAGGTCAAGGTGCTGCTCTTGCGTATCTGGCGGCAGCCCGAGAGGACGCTTGAGATCCTGAAGACC
GTGACAGGTTCCATCATACTCAGGGTGACGTACGGTTATGCCGTCGATCAGGAAAAGAAGGATCCGTTGCTCGAT
ATCGTCGGTCGGATGATGGAGGACCTCTCGGTAGCGTTTACTGCATTAGCGTGGCTAGTCGACCTCATCCCAGCT
CTCCAATATCTGCCCAGCTTCCTGCCGGGGATGGGGTTCAAGAAGACGGCAGAGGAATGCAAGAAGACGAGTCTG
GCGGTGGAAGATATCCCATATGCCTTTACACGGCGCCAGATGGAGTCTTCCAACTCCCGTCCGTCATACGTTTCA
CGACTCTTGCAGGATAGCAGCAGAGATGGCCTCGGGCCGGAGGAGAAGGCAGCCAACGAGGATGACATCAAATGC
ACGGCTTGCATCATCTTTGGCGGAGGCGCTGACACGACCTCGGCGAGCTTAAACGCCTTTGTGCTGGCCATGACG
CTGAACCCAGAGATTCAGAGAAAGGCACAGAAAGAGATTGATTCCCTGACTGGATCAACAAGGCTTCCTAGTTTC
GAGGATCGGTCACAGCTTCCCTACATCGATGCCATCGTGACCGAGACGCTTCGCTGGCTGCCCGTCGCGCCCATG
GGAACAGCCCATATGGCGACGGAGGACGTCTTTTACAACGGCTACCTGATCCCAAAGGGGGCACAGCTGGTGCCT
TCGATATGGTGGTTCACGCACGACCCGGACGTCTACCGGGATCCGGACAGCTTCGACCCGGACCGATACGCGGCC
CGCAACGAACCGGATCCAAGAGCCACCGTCTTTGGCTTCGGCCGGCGACGGTGTCCGGGCATGTACTTTGCCGAA
GCCAATCTGTTCATTATTGTAGCGCAGATGCTGGCAGTCTTTACGATTGGCAAGGTTGTGGGTGAGGATGGGAAG
GAGGTCGAGCCGGAGATTCGGACGACGCCGGGGCTTATCTCGAATGTACTTGGGTTTCCGTTTACGATTAAGGCG
AGAAATGTTGAGTTGCTGCGGGCTGTTGAGGCGGAGAATCCGGGGGTGGAGAGTGATGCTGGTTTGGTGAGGGAA
GAGATTGATGCGAGGATGAAGGCTTGA
Transcript >Ophcf2|02539
ATGGCGAACAAGTTGCTGTTTCAAGCCGTAGGTGTGATTCTCGCCATCATCCTCTATCATCGATACTCGCAGACA
AGACCGGCTGGAAAGCTCCCACCCGGACCGAAGCCTCTCCCACTCCTCGGCAACATCAACGATCTCCCGCCAAAG
GGGATTCCAGAATACCAGCACTGGCTAAAGCACATGCGGAGCTACGGCCCACTGAGCTCCATCACCGTCCTGGGC
CAAACGACCGTCATCTTCCACGACCGGCAGGCGGCCCACGAGCTCCTGGAGCGGACGGCCAAGAAGATGTCTGGG
AGGCCGCGGCTGGTGTTTGGGCCTAAGCTGTGTGGATTCGACCGCATCCTGATAAATAAGCAACCTGATGACGAG
TCTTTTCGATGTCATCGTCGTCTGATGCAGACGCAGTTTGGGTCCAGTTCTGCTGTGGCGGGCTATCATGATGTT
CTGGAGGCTGAGGTCAAGGTGCTGCTCTTGCGTATCTGGCGGCAGCCCGAGAGGACGCTTGAGATCCTGAAGACC
GTGACAGGTTCCATCATACTCAGGGTGACGTACGGTTATGCCGTCGATCAGGAAAAGAAGGATCCGTTGCTCGAT
ATCGTCGGTCGGATGATGGAGGACCTCTCGGTAGCGTTTACTGCATTAGCGTGGCTAGTCGACCTCATCCCAGCT
CTCCAATATCTGCCCAGCTTCCTGCCGGGGATGGGGTTCAAGAAGACGGCAGAGGAATGCAAGAAGACGAGTCTG
GCGGTGGAAGATATCCCATATGCCTTTACACGGCGCCAGATGGAGTCTTCCAACTCCCGTCCGTCATACGTTTCA
CGACTCTTGCAGGATAGCAGCAGAGATGGCCTCGGGCCGGAGGAGAAGGCAGCCAACGAGGATGACATCAAATGC
ACGGCTTGCATCATCTTTGGCGGAGGCGCTGACACGACCTCGGCGAGCTTAAACGCCTTTGTGCTGGCCATGACG
CTGAACCCAGAGATTCAGAGAAAGGCACAGAAAGAGATTGATTCCCTGACTGGATCAACAAGGCTTCCTAGTTTC
GAGGATCGGTCACAGCTTCCCTACATCGATGCCATCGTGACCGAGACGCTTCGCTGGCTGCCCGTCGCGCCCATG
GGAACAGCCCATATGGCGACGGAGGACGTCTTTTACAACGGCTACCTGATCCCAAAGGGGGCACAGCTGGTGCCT
TCGATATGGTGGTTCACGCACGACCCGGACGTCTACCGGGATCCGGACAGCTTCGACCCGGACCGATACGCGGCC
CGCAACGAACCGGATCCAAGAGCCACCGTCTTTGGCTTCGGCCGGCGACGGTGTCCGGGCATGTACTTTGCCGAA
GCCAATCTGTTCATTATTGTAGCGCAGATGCTGGCAGTCTTTACGATTGGCAAGGTTGTGGGTGAGGATGGGAAG
GAGGTCGAGCCGGAGATTCGGACGACGCCGGGGCTTATCTCGAATGTACTTGGGTTTCCGTTTACGATTAAGGCG
AGAAATGTTGAGTTGCTGCGGGCTGTTGAGGCGGAGAATCCGGGGGTGGAGAGTGATGCTGGTTTGGTGAGGGAA
GAGATTGATGCGAGGATGAAGGCTTGA
Gene >Ophcf2|02539
ATGGCGAACAAGTTGCTGTTTCAAGCCGTAGGTGTGATTCTCGCCATCATCCTCTATCATCGATACTCGCAGACA
AGACCGGCTGGAAAGCTCCCACCCGGACCGAAGCCTCTCCCACTCCTCGGCAACATCAACGATCTCCCGCCAAAG
GGGATTCCAGAATACCAGCACTGGCTAAAGCACATGCGGAGCTACGGCCCACTGAGCTCCATCACCGTCCTGGGC
CAAACGACCGTCATCTTCCACGACCGGCAGGCGGCCCACGAGCTCCTGGAGCGGACGGCCAAGAAGATGTCTGGG
AGGCCGCGGCTGGTGTTTGGGCCTAAGCTGTGTGGATTCGACCGCATCCTGATAAATAAGCAACCTGATGACGAG
TCTTTTCGATGTCATCGTCGTCTGATGCAGACGCAGTTTGGGTCCAGTTCTGCTGTGGCGGGCTATCATGATGTT
CTGGAGGCTGAGGTCAAGGTGCTGCTCTTGCGTATCTGGCGGCAGCCCGAGAGGACGCTTGAGATCCTGAAGACG
TACGTCTGTCTGCTGAGAATGAGCCTGATTCGGACGTGGCTAACTTGAACAAGCGTGACAGGTTCCATCATACTC
AGGGTGACGTACGGTTATGCCGTCGATCAGGAAAAGAAGGATCCGTTGCTCGATATCGTCGGTCGGATGATGGAG
GACCTCTCGGTAGCGTTTACTGCATTAGCGTGGCTAGTCGACCTCATCCCAGCTCTCCAATATCTGCCCAGCTTC
CTGCCGGGGATGGGGTTCAAGAAGACGGCAGAGGAATGCAAGAAGACGAGTCTGGCGGTGGAAGATATCCCATAT
GCCTTTACACGGCGCCAGATGGAGTCTTCCAACTCCCGTCCGTCATACGTTTCACGACTCTTGCAGGATAGCAGC
AGAGATGGCCTCGGGCCGGAGGAGAAGGCAGCCAACGAGGATGACATCAAATGCACGGCTTGCATCATCTTTGGC
GGAGGCGCTGACACGACCTCGGCGAGCTTAAACGCCTTTGTGCTGGCCATGACGCTGAACCCAGAGATTCAGAGA
AAGGCACAGAAAGAGATTGATTCCCTGACTGGATCAACAAGGCTTCCTAGTTTCGAGGATCGGTCACAGCTTCCC
TACATCGATGCCATCGTGACCGAGACGCTTCGCTGGCTGCCCGTCGCGCCCATGGGAACAGCCCATATGGCGACG
GAGGACGTCTTTTACAACGGCTACCTGATCCCAAAGGGGGCACAGCTGGTGCCTTCGATATGGTGGTTCACGCAC
GACCCGGACGTCTACCGGGATCCGGACAGCTTCGACCCGGACCGATACGCGGCCCGCAACGAACCGGATCCAAGA
GCCACCGTCTTTGGCTTCGGCCGGCGACGGTGTCCGGGCATGTACTTTGCCGAAGCCAATCTGTTCATTATTGTA
GCGCAGATGCTGGCAGTCTTTACGATTGGCAAGGTTGTGGGTGAGGATGGGAAGGAGGTCGAGCCGGAGATTCGG
ACGACGCCGGGGCTTATCTCGAATGTACTTGGGTTTCCGTTTACGATTAAGGCGAGAAATGTTGAGTTGCTGCGG
GCTGTTGAGGCGGAGAATCCGGGGGTGGAGAGTGATGCTGGTTTGGTGAGGGAAGAGATTGATGCGAGGATGAAG
GCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail