Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02534
Gene name
Locationscaffold_02:4019120..4021558
Strand+
Gene length (bp)2438
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 1.4E-07 5 121

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 281 303 22
2 318 340 22
3 353 375 22
4 398 420 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 4.97 1.33 8.60
Alive In ants, during behavior modification 16.51 6.67 26.34
Dead In ants, recently dead 5.50 1.59 9.41

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.799546 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02534
MSPSTILITGANGSLALAAVSHLLKHAPSQTLLLTVRNAAVDDVNTQALRRLVARRQEGVYIRELDLSRLERVRD
FAREVEADIARGRLPPLASIVCNAYYWNLVGPVEMTVDGFEKSMQVSHLSHAALVMRLIRSCGAPTARILLLSSA
VHRPGRGAPFEKLPPSIPSPLELLVRPEPDADDDRAAHGFQRFMVSQVYTDACFDVKDPSLKHISVVIVNPGVLS
DSRALLVNTPRTICLTSRLLIRPLQPLLRLLMDRTIRTSAEAAVEMARLATNEAVLYIAWSIMAVYVNLAGGIGK
PLWQITLGEYAIWFKGFLASSWMYTSMTAAIRIAILLFYRRIFAQSISWLRRVIHLLLALQAVYVVVYSVLPALA
CRPFDSAWNPFERRAHCDDWFFYYSQVALYSTSMVFDLVLLVLPLQPCSRLQMRRGRKAGVIAMFALGAG*
Coding >Ophcf2|02534
ATGTCACCCTCAACCATCCTCATCACCGGCGCAAACGGCTCCCTCGCCCTCGCCGCCGTATCTCACCTGCTAAAG
CACGCTCCCTCGCAGACGCTCCTCCTCACCGTCCGCAACGCTGCCGTCGACGATGTAAACACCCAGGCTCTTCGA
CGTCTGGTGGCTCGTCGTCAGGAGGGTGTTTACATCCGGGAGCTCGACCTTTCGCGCCTCGAGCGTGTGCGTGAC
TTTGCCCGCGAGGTCGAAGCGGATATCGCGAGGGGGAGACTCCCTCCGCTGGCGAGCATCGTCTGTAACGCCTAC
TACTGGAATCTCGTCGGACCGGTCGAGATGACGGTCGATGGCTTCGAGAAGTCGATGCAAGTCAGCCATCTTTCT
CACGCGGCGCTGGTCATGCGTCTCATCCGAAGCTGCGGCGCGCCGACGGCCCGGATTCTCCTCCTTTCCAGCGCC
GTTCACAGACCCGGACGCGGAGCGCCGTTTGAGAAGCTTCCGCCGTCGATCCCGAGTCCGCTTGAGCTGCTTGTT
CGGCCGGAGCCGGACGCGGACGATGACAGGGCGGCTCATGGCTTTCAGCGGTTCATGGTATCTCAAGTATATACT
GACGCTTGCTTCGACGTCAAGGATCCCTCTCTCAAACACATATCCGTCGTCATCGTCAACCCAGGCGTCCTCAGC
GACTCACGCGCTCTTCTCGTCAACACGCCGCGAACAATCTGCCTCACCTCACGACTTCTCATCCGGCCGCTGCAG
CCGCTCCTCCGCCTGCTCATGGACCGCACCATCCGCACCTCGGCCGAGGCCGCCGTCGAGATGGCCCGGTTGGCG
ACCAATGAGGCTGTTCTCTATATTGCCTGGTCCATCATGGCCGTCTACGTCAATCTAGCCGGGGGAATCGGCAAA
CCGCTATGGCAGATAACCCTCGGCGAGTACGCAATCTGGTTCAAGGGCTTCCTCGCCTCATCCTGGATGTACACG
AGCATGACAGCCGCCATCCGCATCGCCATCCTCCTCTTCTACCGCCGCATCTTCGCCCAGAGCATCTCATGGCTA
AGACGAGTCATCCACCTTCTCCTCGCCCTGCAGGCCGTCTACGTCGTCGTCTACTCCGTTCTACCGGCCCTGGCC
TGCCGTCCGTTCGACAGCGCTTGGAACCCGTTTGAACGCCGGGCTCACTGCGATGACTGGTTCTTTTACTATAGT
CAGGTTGCCTTGTACAGCACTAGCATGGTCTTTGACCTCGTTCTCTTGGTCCTACCGCTCCAGCCTTGCAGCAGG
CTCCAGATGCGCCGCGGTCGAAAGGCCGGTGTCATCGCCATGTTTGCCCTGGGAGCCGGGTGA
Transcript >Ophcf2|02534
ATGTCACCCTCAACCATCCTCATCACCGGCGCAAACGGCTCCCTCGCCCTCGCCGCCGTATCTCACCTGCTAAAG
CACGCTCCCTCGCAGACGCTCCTCCTCACCGTCCGCAACGCTGCCGTCGACGATGTAAACACCCAGGCTCTTCGA
CGTCTGGTGGCTCGTCGTCAGGAGGGTGTTTACATCCGGGAGCTCGACCTTTCGCGCCTCGAGCGTGTGCGTGAC
TTTGCCCGCGAGGTCGAAGCGGATATCGCGAGGGGGAGACTCCCTCCGCTGGCGAGCATCGTCTGTAACGCCTAC
TACTGGAATCTCGTCGGACCGGTCGAGATGACGGTCGATGGCTTCGAGAAGTCGATGCAAGTCAGCCATCTTTCT
CACGCGGCGCTGGTCATGCGTCTCATCCGAAGCTGCGGCGCGCCGACGGCCCGGATTCTCCTCCTTTCCAGCGCC
GTTCACAGACCCGGACGCGGAGCGCCGTTTGAGAAGCTTCCGCCGTCGATCCCGAGTCCGCTTGAGCTGCTTGTT
CGGCCGGAGCCGGACGCGGACGATGACAGGGCGGCTCATGGCTTTCAGCGGTTCATGGTATCTCAAGTATATACT
GACGCTTGCTTCGACGTCAAGGATCCCTCTCTCAAACACATATCCGTCGTCATCGTCAACCCAGGCGTCCTCAGC
GACTCACGCGCTCTTCTCGTCAACACGCCGCGAACAATCTGCCTCACCTCACGACTTCTCATCCGGCCGCTGCAG
CCGCTCCTCCGCCTGCTCATGGACCGCACCATCCGCACCTCGGCCGAGGCCGCCGTCGAGATGGCCCGGTTGGCG
ACCAATGAGGCTGTTCTCTATATTGCCTGGTCCATCATGGCCGTCTACGTCAATCTAGCCGGGGGAATCGGCAAA
CCGCTATGGCAGATAACCCTCGGCGAGTACGCAATCTGGTTCAAGGGCTTCCTCGCCTCATCCTGGATGTACACG
AGCATGACAGCCGCCATCCGCATCGCCATCCTCCTCTTCTACCGCCGCATCTTCGCCCAGAGCATCTCATGGCTA
AGACGAGTCATCCACCTTCTCCTCGCCCTGCAGGCCGTCTACGTCGTCGTCTACTCCGTTCTACCGGCCCTGGCC
TGCCGTCCGTTCGACAGCGCTTGGAACCCGTTTGAACGCCGGGCTCACTGCGATGACTGGTTCTTTTACTATAGT
CAGGTTGCCTTGTACAGCACTAGCATGGTCTTTGACCTCGTTCTCTTGGTCCTACCGCTCCAGCCTTGCAGCAGG
CTCCAGATGCGCCGCGGTCGAAAGGCCGGTGTCATCGCCATGTTTGCCCTGGGAGCCGGGTGA
Gene >Ophcf2|02534
ATGTCACCCTCAACCATCCTCATCACCGGCGCAAACGGCTCCCTCGCCCTCGCCGCCGTATCTCACCTGCTAAAG
CACGCTCCCTCGCAGACGCTCCTCCTCACCGTCCGCAACGCTGCCGTCGACGATGTAAACACCCAGGCTCTTCGA
CGTCTGGTGGCTCGTCGTCAGGAGGGTGTTTACATCCGGGAGCTCGACCTTTCGCGCCTCGAGCGTGTGCGTGAC
TTTGCCCGCGAGGTCGAAGCGGATATCGCGAGGGGGAGACTCCCTCCGCTGGCGAGCATCGTCTGTAACGCCTAC
TACTGGAATCTCGTCGGACCGGTCGAGATGACGGTCGATGGCTTCGAGAAGTCGATGCAAGTCAGCCATCTTTCT
CACGCGGCGCTGGTCATGCGTCTCATCCGAAGCTGCGGCGCGCCGACGGCCCGGATTCTCCTCCTTTCCAGCGCC
GTTCACAGACCCGGACGCGGAGCGCCGTTTGAGAAGCTTCCGCCGTCGATCCCGAGTCCGCTTGAGCTGCTTGTT
CGGCCGGAGCCGGACGCGGACGATGACAGGGCGGCTCATGGCTTTCAGCGGTATGCCACTGCCAAGTTGGTTATT
ACTGCTTGGGGGTTTGCCTTGCTGCGTCGTTTACAAAAGGTTTTTTGTTGTTTCTCGGCTTGTCTTTTTTCAGGT
TCATGGTATCTCAAGTATATACTGACGCTTGCTTCGACGTCAAGGATCCCTCTCTCAAACACATATCCGTCGTCA
TCGTCAACCCAGGCGTCCTCAGCGACTCACGCGCTCTTCTCGTCAACACGCCGCGAACAATCTGCCTCACCTCAC
GACTTCTCATCCGGCCGCTGCAGCCGCTCCTCCGCCTGCTCATGGACCGCACCATCCGCACCTCGGCCGAGGCCG
CCGTCGAGATGGCCCGGTTGGCGACCAATGAGGCTGTGCCCGGCCAGAGCGGCTTCTTTACCATGCTGGAGAGGG
ATGAGAGTTCCGAGGAGAGTAGGGATCGGGGGGTGCAGGAGGCGCTTTGGGAGGCGAGTGCTCGGTGGTTGGGGG
TGAGTGGTGAGCTGTAGTTGAGGATGGGGAACTGCATCGGAATTTGTATTTTACGTGTAATCTGTATTAATCTGA
ATGTGAACCTGAAGGGAGGCTGACCGAGGAGACGGTGGATTCGAAGCCTTCCTCACTTGTATTAAAATCAACGTC
CAAAGTTCAATATATATGTATATGTTGTTTCAACTTCATTCTCTCATCATCAACAACATAGACACTCGGTACATG
TAGTTCAATCCCATCAGTTAACAAAACCCCATCAACATCCCGTCATATCCCTCGTACAACTCACCCTCACATCAC
ACCTACACGACACTCACCCCATCCCAACACGAGCCCTCCCAATTCATGTGCATATAGGCGCGGGATCCCACCCCA
ACAACCTCAACTGCAACTCCCCACATGCCCAACATCAAGACAAGGCCTCCGACACGAAACCCTCTCCATTTCCAA
TGCAGGGGACGCCCATCAGCGTCTATCAACCGCCTCGATATACGAGTCCTTATCCCCTTCTAAGCCCCCCCCCCC
CCCCCCTCAACTTCACCTCTCACCTCCATCCCTCGTTCCTTCACCCAGACTGCTGATCATGGCGCAGAACCTAAC
TGAGCAGCTGGCCTCGTTGCTTCCTCCGCCAACTATCGTCGACGACAGTAACAAGGCGTACGGCGTGTCTATTGC
GTGTGCGTTGCTGAGTGGTCTGACTACCTCGGTCGTTGCGTGGCGTCTTTACCTACGTTATGCTTCGCGTGCCTT
TGGTCTCGATGACTGGGCCACTGTTCCCGCCCTTGTGGGAACCCCTATTCCACGAGAATCAAGACGACAGAAGAC
TGACTATCAAGACAGGTTCTCTATATTGCCTGGTCCATCATGGCCGTCTACGTCAATCTAGCCGGGGGAATCGGC
AAACCGCTATGGCAGATAACCCTCGGCGAGTACGCAATCTGGTTCAAGGTAAGCCCCGTCCACCAGCCCAAAGAA
ACCTCACCAACAACCACCAGGGCTTCCTCGCCTCATCCTGGATGTACACGAGCATGACAGCCGCCATCCGCATCG
CCATCCTCCTCTTCTACCGCCGCATCTTCGCCCAGAGCATCTCATGGCTAAGACGAGTCATCCACCTTCTCCTCG
CCCTGCAGGCCGTCTACGTCGTCGTCTACTCCGTTCTACCGGCCCTGGCCTGCCGTCCGTTCGACAGCGCTTGGA
ACCCGTTTGAACGCCGGGCTCACTGCGATGACTGGTTCTTTTACTATAGTCAGGTTGCCTTGTACAGCACTAGCA
TGGTCTTTGACCTCGTTCTCTTGGTCCTACCGCTCCAGCCTTGCAGCAGGCTCCAGATGCGCCGCGGTCGAAAGG
CCGGTGTCATCGCCATGTTTGCCCTGGGAGCCGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail