Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02533
Gene name
Locationscaffold_02:4015773..4018858
Strand-
Gene length (bp)3085
Transcript length (bp)2466
Coding sequence length (bp)2466
Protein length (aa) 822

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 3.7E-38 536 798
PF01565 FAD_binding_4 FAD binding domain 1.7E-28 65 200

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0016021 integral component of membrane Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016740 transferase activity No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043167 ion binding No
GO:0031224 intrinsic component of membrane No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 604 626 22
2 657 679 22
3 689 711 22
4 736 758 22
5 791 813 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02533
MLAQTALLTSLVARVSAQQQPASTPWELACLHLGVVSSTATIFPWSRGYGAISEQNWSGTARAKPACIVRPENAS
QVQTVVRLLSRRRVPFAIRSGGHNPAPGSASIKDGVLLDLSRLDDLFYQSDSRTVTVGTGNKWTAVYSLLHQHDV
TVVGGRILDVGVGGLLLGSGLSWMSNLHGLGCDNVAEHEAVLANGTLIRANERDHADLHWALKGGGNNFAVVTSF
KLHTYPIGRVWGGIRLYPLSRLPALYEALAEYQTAASQDSHANVMLQAFPTNSTMGAVLTLVYLKPEARPAIFAP
FYRVPFTADATKVRSYLDLLASTRIPRLPRYDWHALTVKPDAQLYGLIHNLTSSPTNLEPLTRLTSGTLAVGLQP
VSRKAVLRGRSRAGGNALGLSAEAQTWLVVGGGWHWPSADEAGHDAVARVRSELAGAAASSGLRLPYLFMNDASW
DQRVLASYGLENVERLRRVQRAYDPEGVFQEVVPGGFKLGQLQRINAGHPLRRPPRQPLGLTPPPSWIPLVQLAR
LSPPVGLALVFLPHLYGALLAAIEQRAPLHRLLRACAVLAAGTFFFSNAAHGWNDVVDAPVDRLVARTRTRPIPR
GALSGTAAVVFVFSQAVGVVAVLLLLMPARSAPWALPAYIASTYYPWAKRQTHLAQLVLGFCLAWGVVVGAVGLG
GSGSEDVVVSPVRHVPTVCLVSACIVWTTVYDTIYAHQDAADDARIGLKSMALLLRGRTKAVLWLMVCLMAVLLA
AAGIAASMAWPYFLITTLGSALSLGVMVARVELQDPASCWWWFRYGFWLTGSAIAAGLSCEYLMRLSFRSV*
Coding >Ophcf2|02533
ATGCTGGCTCAAACAGCCCTCCTGACCTCCCTCGTCGCCCGGGTTTCCGCCCAGCAACAGCCAGCCTCGACTCCC
TGGGAACTCGCCTGCCTCCACCTAGGCGTCGTCTCCTCCACGGCCACCATATTCCCTTGGAGCAGAGGCTACGGT
GCCATCAGCGAGCAGAACTGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCGTCT
CAGGTTCAGACGGTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCATTCGCCATCCGATCGGGGGGACATAATCCT
GCCCCCGGGTCGGCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGCCGGTTGGATGACCTCTTCTACCAGTCT
GACTCCAGGACGGTCACCGTAGGGACCGGCAACAAGTGGACGGCTGTCTATTCTCTCCTCCATCAGCATGACGTG
ACCGTCGTAGGCGGCAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCGGCCTATCGTGGATGTCG
AATCTGCACGGCCTTGGTTGCGATAACGTGGCCGAACACGAGGCCGTCCTCGCCAACGGCACCTTGATCAGGGCA
AACGAAAGAGATCACGCGGATCTACACTGGGCTCTCAAGGGCGGCGGCAACAACTTCGCCGTCGTCACCTCCTTC
AAGCTGCACACGTACCCCATCGGCCGCGTCTGGGGCGGCATCAGACTGTATCCTCTCAGCAGGCTTCCGGCCCTG
TACGAGGCCCTGGCCGAGTATCAAACCGCAGCCAGCCAGGACTCGCACGCCAACGTCATGCTGCAGGCCTTTCCC
ACCAACTCGACCATGGGCGCTGTCCTGACGCTCGTCTACCTCAAGCCCGAGGCCAGGCCGGCCATCTTCGCGCCC
TTTTATCGTGTTCCCTTTACCGCTGACGCCACCAAGGTCCGCTCCTATCTCGACCTGCTGGCCAGCACCCGTATC
CCCCGGCTGCCCAGATACGACTGGCACGCCTTGACCGTCAAGCCCGACGCCCAGCTCTACGGTCTGATCCATAAC
CTCACCTCGTCTCCCACTAACCTGGAGCCCCTGACGCGTCTCACATCCGGCACCCTCGCAGTCGGCCTGCAGCCC
GTGAGCCGCAAAGCCGTACTGAGAGGCCGGTCCCGCGCCGGCGGCAACGCCCTCGGCCTCTCCGCCGAAGCCCAG
ACGTGGCTCGTCGTAGGCGGCGGCTGGCACTGGCCCTCGGCTGACGAGGCGGGACACGATGCCGTCGCCCGGGTG
CGTTCCGAGCTGGCCGGAGCCGCTGCCTCTTCCGGACTCAGACTGCCGTATCTATTTATGAACGACGCCAGTTGG
GATCAGCGCGTGCTGGCCAGCTACGGTCTGGAAAACGTCGAGCGGTTGCGACGGGTGCAGCGGGCGTATGACCCT
GAGGGGGTCTTTCAGGAGGTCGTTCCGGGGGGATTCAAGCTGGGGCAGTTGCAACGGATCAATGCTGGCCACCCA
CTACGGCGGCCTCCACGGCAGCCCCTGGGTCTCACGCCTCCCCCCTCCTGGATCCCCCTCGTACAGCTCGCTCGG
CTCAGCCCCCCCGTCGGCCTGGCCCTCGTCTTCCTCCCGCACTTATACGGCGCCCTGTTGGCCGCCATCGAGCAG
CGAGCTCCCCTCCATCGCCTACTCCGTGCCTGTGCCGTCCTCGCAGCCGGCACCTTCTTCTTCTCCAATGCGGCT
CACGGGTGGAACGACGTGGTGGACGCTCCCGTTGACCGGCTCGTGGCCCGGACACGCACCCGGCCCATCCCCCGT
GGCGCCCTCTCCGGTACGGCCGCCGTCGTCTTCGTCTTCAGTCAGGCCGTGGGAGTCGTGGCCGTACTGCTGCTG
TTGATGCCTGCTCGTTCTGCGCCCTGGGCTCTCCCGGCTTACATCGCCTCGACCTACTACCCCTGGGCCAAGAGG
CAGACACATCTGGCTCAGTTGGTTCTGGGCTTCTGTCTGGCCTGGGGAGTCGTCGTCGGCGCCGTCGGTCTCGGA
GGATCTGGGTCTGAGGACGTGGTCGTTTCGCCGGTTCGTCACGTCCCGACTGTCTGTTTGGTTTCCGCCTGTATC
GTCTGGACGACCGTCTACGACACCATCTACGCCCACCAGGACGCGGCCGACGACGCTCGCATCGGACTCAAGAGC
ATGGCACTGTTGCTACGTGGCCGTACAAAGGCCGTCTTGTGGCTGATGGTGTGTCTCATGGCCGTTCTGCTGGCG
GCTGCTGGCATCGCCGCTTCGATGGCCTGGCCGTACTTTCTCATCACCACCTTGGGGTCTGCGCTCTCGCTGGGA
GTCATGGTAGCTCGCGTTGAGCTTCAAGATCCGGCCAGCTGCTGGTGGTGGTTTCGCTACGGCTTTTGGCTCACG
GGCTCGGCCATCGCTGCCGGCTTGTCGTGCGAGTATCTCATGAGGCTCTCCTTCAGATCCGTATGA
Transcript >Ophcf2|02533
ATGCTGGCTCAAACAGCCCTCCTGACCTCCCTCGTCGCCCGGGTTTCCGCCCAGCAACAGCCAGCCTCGACTCCC
TGGGAACTCGCCTGCCTCCACCTAGGCGTCGTCTCCTCCACGGCCACCATATTCCCTTGGAGCAGAGGCTACGGT
GCCATCAGCGAGCAGAACTGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCGTCT
CAGGTTCAGACGGTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCATTCGCCATCCGATCGGGGGGACATAATCCT
GCCCCCGGGTCGGCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGCCGGTTGGATGACCTCTTCTACCAGTCT
GACTCCAGGACGGTCACCGTAGGGACCGGCAACAAGTGGACGGCTGTCTATTCTCTCCTCCATCAGCATGACGTG
ACCGTCGTAGGCGGCAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCGGCCTATCGTGGATGTCG
AATCTGCACGGCCTTGGTTGCGATAACGTGGCCGAACACGAGGCCGTCCTCGCCAACGGCACCTTGATCAGGGCA
AACGAAAGAGATCACGCGGATCTACACTGGGCTCTCAAGGGCGGCGGCAACAACTTCGCCGTCGTCACCTCCTTC
AAGCTGCACACGTACCCCATCGGCCGCGTCTGGGGCGGCATCAGACTGTATCCTCTCAGCAGGCTTCCGGCCCTG
TACGAGGCCCTGGCCGAGTATCAAACCGCAGCCAGCCAGGACTCGCACGCCAACGTCATGCTGCAGGCCTTTCCC
ACCAACTCGACCATGGGCGCTGTCCTGACGCTCGTCTACCTCAAGCCCGAGGCCAGGCCGGCCATCTTCGCGCCC
TTTTATCGTGTTCCCTTTACCGCTGACGCCACCAAGGTCCGCTCCTATCTCGACCTGCTGGCCAGCACCCGTATC
CCCCGGCTGCCCAGATACGACTGGCACGCCTTGACCGTCAAGCCCGACGCCCAGCTCTACGGTCTGATCCATAAC
CTCACCTCGTCTCCCACTAACCTGGAGCCCCTGACGCGTCTCACATCCGGCACCCTCGCAGTCGGCCTGCAGCCC
GTGAGCCGCAAAGCCGTACTGAGAGGCCGGTCCCGCGCCGGCGGCAACGCCCTCGGCCTCTCCGCCGAAGCCCAG
ACGTGGCTCGTCGTAGGCGGCGGCTGGCACTGGCCCTCGGCTGACGAGGCGGGACACGATGCCGTCGCCCGGGTG
CGTTCCGAGCTGGCCGGAGCCGCTGCCTCTTCCGGACTCAGACTGCCGTATCTATTTATGAACGACGCCAGTTGG
GATCAGCGCGTGCTGGCCAGCTACGGTCTGGAAAACGTCGAGCGGTTGCGACGGGTGCAGCGGGCGTATGACCCT
GAGGGGGTCTTTCAGGAGGTCGTTCCGGGGGGATTCAAGCTGGGGCAGTTGCAACGGATCAATGCTGGCCACCCA
CTACGGCGGCCTCCACGGCAGCCCCTGGGTCTCACGCCTCCCCCCTCCTGGATCCCCCTCGTACAGCTCGCTCGG
CTCAGCCCCCCCGTCGGCCTGGCCCTCGTCTTCCTCCCGCACTTATACGGCGCCCTGTTGGCCGCCATCGAGCAG
CGAGCTCCCCTCCATCGCCTACTCCGTGCCTGTGCCGTCCTCGCAGCCGGCACCTTCTTCTTCTCCAATGCGGCT
CACGGGTGGAACGACGTGGTGGACGCTCCCGTTGACCGGCTCGTGGCCCGGACACGCACCCGGCCCATCCCCCGT
GGCGCCCTCTCCGGTACGGCCGCCGTCGTCTTCGTCTTCAGTCAGGCCGTGGGAGTCGTGGCCGTACTGCTGCTG
TTGATGCCTGCTCGTTCTGCGCCCTGGGCTCTCCCGGCTTACATCGCCTCGACCTACTACCCCTGGGCCAAGAGG
CAGACACATCTGGCTCAGTTGGTTCTGGGCTTCTGTCTGGCCTGGGGAGTCGTCGTCGGCGCCGTCGGTCTCGGA
GGATCTGGGTCTGAGGACGTGGTCGTTTCGCCGGTTCGTCACGTCCCGACTGTCTGTTTGGTTTCCGCCTGTATC
GTCTGGACGACCGTCTACGACACCATCTACGCCCACCAGGACGCGGCCGACGACGCTCGCATCGGACTCAAGAGC
ATGGCACTGTTGCTACGTGGCCGTACAAAGGCCGTCTTGTGGCTGATGGTGTGTCTCATGGCCGTTCTGCTGGCG
GCTGCTGGCATCGCCGCTTCGATGGCCTGGCCGTACTTTCTCATCACCACCTTGGGGTCTGCGCTCTCGCTGGGA
GTCATGGTAGCTCGCGTTGAGCTTCAAGATCCGGCCAGCTGCTGGTGGTGGTTTCGCTACGGCTTTTGGCTCACG
GGCTCGGCCATCGCTGCCGGCTTGTCGTGCGAGTATCTCATGAGGCTCTCCTTCAGATCCGTATGA
Gene >Ophcf2|02533
ATGCTGGCTCAAACAGCCCTCCTGACCTCCCTCGTCGCCCGGGTTTCCGCCCAGCAACAGCCAGCCTCGACTCCC
TGGGAACTCGCCTGCCTCCACCTAGGCGTCGTCTCCTCCACGGCCACCATATTCCCTTGGAGCAGAGGCTACGGT
GCCATCAGCGAGCAGAACTGGTGCGTACATACCTATAGGCTATCTATCCTACCTGCATGGCCAGGCCCGCCACCC
CCCCCCCCCTCCCCGTACGACTGAGCCCCCCCCGTCGCAGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCG
TCCGGCCCGAGAACGCGTCTCAGGTTCAGACGGTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCATTCGCCATCC
GATCGGGGGGACATAATCCTGCCCCCGGGTCGGCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGCCGGTTGG
ATGACCTCTTCTACCAGTCTGACTCCAGGACGGTCACCGTAGGGACCGGCAACAAGTGGACGGCTGTCTATTCTC
TCCTCCATCAGCATGACGTGACCGTCGTAGGCGGCAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAA
GCAAGTCATCTCCCCCATGCAGATATTGGCTGCTGCTGACGGGTAAAGGCGGCCTATCGTGGATGTCGAATCTGC
ACGGCCTTGGTTGCGATAACGTGGCCGAACACGAGGTGATGCCATCTCATACATCACCCCCCTGAACGAAACAGA
GCAACTGACGGGGTGGGAAACCAAAGGCCGTCCTCGCCAACGGCACCTTGATCAGGGCAAACGAAAGAGATCACG
CGGATCTACACTGGGCTCTCAAGGGCGGCGGCAACAACTTCGGTATCCCCGTTCCCCGGCCCCGTGTCCTCATAC
ACATATACCTACATACGTCACTAACACGCCCCCTGAAGCCGTCGTCACCTCCTTCAAGCTGCACACGTACCCCAT
CGGCCGCGTCTGGGGCGGCATCAGACTGTATCCTCTCAGCAGGCTTCCGGCCCTGTACGAGGCCCTGGCCGAGTA
TCAAACCGCAGCCAGCCAGGACTCGCACGCCAACGTCATGCTGCAGGCCTTTCCCACCAACTCGACCATGGGCGC
TGTCCTGACGCTCGTCTACCTCAAGCCCGAGGCCAGGCCGGCCATCTTCGCGCCCTTTTATCGTGTTCCCTTTAC
CGCTGACGCCACCAAGGTCCGCTCCTATCTCGACCTGCTGGCCAGCACCCGTATCCCCCGGCTGCCCAGATACGA
CTGGCACGCCTTGACCGTCAAGCCCGACGCCCAGCTCTACGGTCTGATCCATAACCTCACCTCGTCTCCCACTAA
CCTGGAGCCCCTGACGCGTCTCACATCCGGCACCCTCGCAGTCGGCCTGCAGCCCGTGAGCCGCAAAGCCGTACT
GAGAGGCCGGTCCCGCGCCGGCGGCAACGCCCTCGGCCTCTCCGCCGAAGCCCAGACGTGGCTCGTCGTAGGCGG
CGGCTGGCACTGGCCCTCGGCTGACGAGGCGGGACACGATGCCGTCGCCCGGGTGCGTTCCGAGCTGGCCGGAGC
CGCTGCCTCTTCCGGACTCAGACTGCCGTATCTATTTATGAACGACGCCAGTTGGGATCAGCGCGTGCTGGCCAG
CTACGGTCTGGAAAACGTCGAGCGGTTGCGACGGGTGCAGCGGGCGTATGACCCTGAGGGGGTCTTTCAGGAGGT
CGTTCCGGGGGGATTCAAGCTGGGGGTTGGGTGGTGAAGGGGGAGTATATGGATAGGTATGTTTGTCTTCGTATT
TTGTGCGTGACAGTAGAAGGGGGTAATTCGATATCAATACCGTAGCAGTTGCAACGGATCAATGCTGGGTGGGCG
TCTGGGAACATACGTGTAAAAAGGGGCTTCCGTATAAGACAGACCAACGAGGCGGCTCTTCCAACCGGCAGTTAT
ATACCCTCTTCTAGTACATCAAAAACACAAAATTGGGCATCACTACCTTGCCTTTGAGGTGCACAGATCATACCG
AGAGACCAACACCTCGGAACCGCAACCCCCAACAACCCCTATCCGCAACCCGCCATGACCGCCAAAACACCATCA
CGCCCCCCCTAGCCACCCACTACGGCGGCCTCCACGGCAGCCCCTGGGTCTCACGCCTCCCCCCTCCTGGATCCC
CCTCGTACAGCTCGCTCGGCTCAGCCCCCCCGTCGGCCTGGCCCTCGTCTTCCTCCCGCACTTATACGGCGCCCT
GTTGGCCGCCATCGAGCAGCGAGCTCCCCTCCATCGCCTACTCCGTGCCTGTGCCGTCCTCGCAGCCGGCACCTT
CTTCTTCTCCAATGCGGCTCACGGGTGGAACGACGTGGTGGACGCTCCCGTTGACCGGCTCGTGGCCCGGACACG
CACCCGGCCCATCCCCCGTGGCGCCCTCTCCGGTACGGCCGCCGTCGTCTTCGTCTTCAGTCAGGCCGTGGGAGT
CGTGGCCGTACTGCTGCTGTTGATGCCTGCTCGTTCTGCGCCCTGGGCTCTCCCGGCTTACATCGCCTCGACCTA
CTACCCCTGGGCCAAGAGGCAGACACATCTGGCTCAGTTGGTTCTGGGCTTCTGTCTGGCCTGGGGAGTCGTCGT
CGGCGCCGTCGGTCTCGGAGGATCTGGGTCTGAGGACGTGGTCGTTTCGCCGGTTCGTCACGTCCCGACTGTCTG
TTTGGTTTCCGCCTGTATCGTCTGGACGACCGTCTACGACACCATCTACGCCCACCAGGACGCGGCCGACGACGC
TCGCATCGGACTCAAGAGCATGGCACTGTTGCTACGTGGCCGTACAAAGGCCGTCTTGTGGCTGATGGTGTGTCT
CATGGCCGTTCTGCTGGCGGCTGCTGGCATCGCCGCTTCGATGGCCTGGCCGTACTTTCTCATCACCACCTTGGG
GTCTGCGCTCTCGCTGGGAGTCATGGTAGCTCGCGTTGAGCTTCAAGATCCGGCCAGCTGCTGGTGGTGGTTTCG
CTACGGCTTTTGGCTCACGGGCTCGGCCATCGCTGCCGGCTTGTCGTGCGAGTATCTCATGAGGCTCTCCTTCAG
ATCCGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail