Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02530
Gene name
Locationscaffold_02:4010328..4011987
Strand+
Gene length (bp)1659
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04506 Rft-1 Rft protein 7.8E-16 9 97
PF04506 Rft-1 Rft protein 5.6E-95 111 482

GO

GO Term Description Terminal node
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0006629 lipid metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 79 101 22
2 141 163 22
3 290 312 22
4 327 349 22
5 361 383 22
6 387 406 19
7 418 440 22
8 455 473 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02530
MPSPAKSRLRGASLLITLQLTSRLITFTANQVFLLRHVTAPQLGHAARLEASAATVLFLARDGLRVAVPRVRRPE
PQTLVNLGYLSAAVGAVVLAVGLLGWGGGRLGAGFAESAAVLARCLVLFLAVRSWADGDGENEHRVLPFALGQLA
YALTLLITYTITLYRLASALKFSLLPRASSSGYLDGGAVRLAASVSAQGIVKHLLTQGDTLLVAVLAPPRVQGVY
ALANNYGGLLARLLFQPIEESCRGYFSLLLSPEKQSSTEKDDGPSEAKVAAVVEASRSLAVLARLYLLLSVIVVS
LGPFAAPPLLALVAGGRWSDAGAGRVLATYSLYVPFLALNGLAEAFVASVATERHLRRQSLAMAVFSIVFAVAAG
LLMRVLGWGAHGLVVANMVNLLCRICWCAVFIKDYFGRRSHAFSLTALFPRHAFAAASAIAAVLVRLRLHHGAES
EPIRTLAMVAAWAIPLLAITAFLERDLLLQCLHSVRGKEASKP*
Coding >Ophcf2|02530
ATGCCCTCGCCGGCAAAATCCCGTCTACGAGGCGCCTCCCTCCTGATAACCCTCCAGCTAACAAGCCGCCTCATC
ACCTTCACCGCCAACCAAGTCTTCCTCCTCCGCCACGTCACCGCCCCGCAACTCGGCCACGCCGCCCGTCTCGAA
GCCTCCGCCGCGACGGTCCTCTTCCTCGCCCGCGATGGCCTCCGCGTCGCCGTCCCGCGCGTCCGCCGGCCGGAG
CCCCAGACCCTCGTGAACCTCGGATACCTCTCCGCCGCGGTGGGCGCCGTCGTCTTGGCGGTCGGGCTGCTCGGC
TGGGGGGGGGGGAGGTTGGGGGCGGGCTTTGCCGAGTCGGCGGCGGTTCTGGCTCGTTGTCTCGTCCTCTTTCTC
GCTGTTCGCTCTTGGGCGGATGGTGATGGTGAGAACGAGCATCGTGTCTTGCCGTTTGCTCTCGGACAGCTCGCC
TACGCACTCACCCTCCTCATAACCTACACCATCACCCTCTACCGTCTCGCCTCGGCCCTCAAATTCTCGCTCCTC
CCGCGGGCCTCGTCCAGCGGATACCTCGATGGAGGTGCCGTGCGACTGGCTGCCTCTGTTTCGGCGCAGGGGATT
GTCAAGCATCTTCTCACCCAGGGGGATACCCTTCTCGTTGCGGTTCTGGCGCCGCCTCGTGTTCAGGGTGTTTAT
GCGCTGGCTAACAACTATGGTGGTTTGCTGGCTCGTCTGCTCTTTCAACCTATTGAGGAGTCCTGTCGAGGCTAC
TTTTCGCTTCTACTTTCGCCCGAGAAGCAGTCCTCGACGGAGAAAGATGATGGCCCCTCCGAAGCCAAAGTCGCC
GCCGTCGTCGAAGCAAGTCGCAGCCTCGCCGTCCTCGCAAGACTCTATCTCCTTCTCTCCGTCATCGTCGTCTCC
CTCGGCCCCTTTGCCGCCCCGCCGCTGCTGGCTCTCGTGGCCGGTGGTCGCTGGTCCGACGCCGGCGCCGGCCGC
GTGCTCGCTACTTATAGCCTCTACGTGCCCTTCCTGGCTCTCAACGGCCTGGCTGAGGCTTTCGTCGCCTCGGTT
GCCACTGAGCGTCATCTTCGCCGCCAGTCTTTGGCAATGGCAGTCTTTAGCATCGTCTTTGCCGTCGCTGCTGGT
CTTCTCATGCGCGTCTTGGGCTGGGGTGCTCATGGGCTCGTCGTCGCTAACATGGTTAACCTGCTGTGTCGCATC
TGCTGGTGCGCCGTCTTCATCAAGGACTATTTTGGTCGTCGGAGCCACGCCTTTTCCCTGACGGCTTTATTTCCT
CGTCACGCATTTGCCGCCGCCTCTGCAATTGCTGCTGTTCTCGTCCGCTTGCGTCTTCACCATGGCGCAGAGTCT
GAGCCGATCCGAACTCTTGCCATGGTTGCTGCTTGGGCCATTCCTCTGCTCGCCATCACAGCCTTCTTGGAGAGA
GACTTGCTGCTTCAATGTCTGCACTCCGTCCGCGGGAAAGAGGCCAGCAAGCCCTGA
Transcript >Ophcf2|02530
ATGCCCTCGCCGGCAAAATCCCGTCTACGAGGCGCCTCCCTCCTGATAACCCTCCAGCTAACAAGCCGCCTCATC
ACCTTCACCGCCAACCAAGTCTTCCTCCTCCGCCACGTCACCGCCCCGCAACTCGGCCACGCCGCCCGTCTCGAA
GCCTCCGCCGCGACGGTCCTCTTCCTCGCCCGCGATGGCCTCCGCGTCGCCGTCCCGCGCGTCCGCCGGCCGGAG
CCCCAGACCCTCGTGAACCTCGGATACCTCTCCGCCGCGGTGGGCGCCGTCGTCTTGGCGGTCGGGCTGCTCGGC
TGGGGGGGGGGGAGGTTGGGGGCGGGCTTTGCCGAGTCGGCGGCGGTTCTGGCTCGTTGTCTCGTCCTCTTTCTC
GCTGTTCGCTCTTGGGCGGATGGTGATGGTGAGAACGAGCATCGTGTCTTGCCGTTTGCTCTCGGACAGCTCGCC
TACGCACTCACCCTCCTCATAACCTACACCATCACCCTCTACCGTCTCGCCTCGGCCCTCAAATTCTCGCTCCTC
CCGCGGGCCTCGTCCAGCGGATACCTCGATGGAGGTGCCGTGCGACTGGCTGCCTCTGTTTCGGCGCAGGGGATT
GTCAAGCATCTTCTCACCCAGGGGGATACCCTTCTCGTTGCGGTTCTGGCGCCGCCTCGTGTTCAGGGTGTTTAT
GCGCTGGCTAACAACTATGGTGGTTTGCTGGCTCGTCTGCTCTTTCAACCTATTGAGGAGTCCTGTCGAGGCTAC
TTTTCGCTTCTACTTTCGCCCGAGAAGCAGTCCTCGACGGAGAAAGATGATGGCCCCTCCGAAGCCAAAGTCGCC
GCCGTCGTCGAAGCAAGTCGCAGCCTCGCCGTCCTCGCAAGACTCTATCTCCTTCTCTCCGTCATCGTCGTCTCC
CTCGGCCCCTTTGCCGCCCCGCCGCTGCTGGCTCTCGTGGCCGGTGGTCGCTGGTCCGACGCCGGCGCCGGCCGC
GTGCTCGCTACTTATAGCCTCTACGTGCCCTTCCTGGCTCTCAACGGCCTGGCTGAGGCTTTCGTCGCCTCGGTT
GCCACTGAGCGTCATCTTCGCCGCCAGTCTTTGGCAATGGCAGTCTTTAGCATCGTCTTTGCCGTCGCTGCTGGT
CTTCTCATGCGCGTCTTGGGCTGGGGTGCTCATGGGCTCGTCGTCGCTAACATGGTTAACCTGCTGTGTCGCATC
TGCTGGTGCGCCGTCTTCATCAAGGACTATTTTGGTCGTCGGAGCCACGCCTTTTCCCTGACGGCTTTATTTCCT
CGTCACGCATTTGCCGCCGCCTCTGCAATTGCTGCTGTTCTCGTCCGCTTGCGTCTTCACCATGGCGCAGAGTCT
GAGCCGATCCGAACTCTTGCCATGGTTGCTGCTTGGGCCATTCCTCTGCTCGCCATCACAGCCTTCTTGGAGAGA
GACTTGCTGCTTCAATGTCTGCACTCCGTCCGCGGGAAAGAGGCCAGCAAGCCCTGA
Gene >Ophcf2|02530
ATGCCCTCGCCGGCAAAATCCCGTCTACGAGGCGCCTCCCTCCTGATAACCCTCCAGCTAACAAGCCGCCTCATC
ACCTTCACCGCCAACCAAGTCTTCCTCCTCCGCCACGTCACCGCCCCGCAACTCGGCCACGCCGCCCGTCTCGAA
GCCTCCGCCGCGACGGTCCTCTTCCTCGCCCGCGATGGCCTCCGCGTCGCCGTCCCGCGCGTCCGCCGGCCGGAG
CCCCAGACCCTCGTGAACCTCGGATACCTCTCCGCCGCGGTGGGCGCCGTCGTCTTGGCGGTCGGGCTGCTCGGC
TGGGGGGGTTGGGGGGGGGATGGGGGGGGTGCGAGGGGTTTATGGGCTGGCGGTGGGGGGGAGTTATTGGCTGAG
CCGGCGTTTTGCTGTTGTTGGCGAGGGGGGAGGTTGGGGGCGGGCTTTGCCGAGTCGGCGGCGGTTCTGGCTCGT
TGTCTCGTCCTCTTTCTCGCTGTTCGCTCTTGGGCGGATGGTGATGGTGAGAACGAGCATCGTGTCTTGCCGTTT
GCTCTCGGACAGCTCGCCTACGCACTCACCCTCCTCATAACCTACACCATCACCCTCTACCGTCTCGCCTCGGCC
CTCAAATTCTCGCTCCTCCCGCGGGCCTCGTCCAGCGGATACCTCGATGGAGGTGCCGTGCGACTGGCTGCCTCT
GTTTCGGCGCAGGGGATTGTCAAGCATCTTCTCACCCAGGGGGATACCCTTCTCGTTGCGGTTCTGGCGCCGCCT
CGTGTTCAGGGTGTTTATGCGCTGGCTAACAACTATGGTGGTTTGCTGGCTCGTCTGCTCTTTCAACCTATTGAG
GAGTCCTGTCGAGGCTACTTTTCGCTTCTACTTTCGCCCGAGAAGCAGTCCTCGACGGAGAAAGATGATGGCCCC
TCCGAAGCCAAAGTCGCCGCCGTCGTCGAAGCAAGTCGCAGCCTCGCCGTCCTCGCAAGACTCTATCTCCTTCTC
TCCGTCATCGTCGTCTCCCTCGGCCCCTTTGCCGCCCCGCCGCTGCTGGCTCTCGTGGCCGGTGGTCGCTGGTCC
GACGCCGGCGCCGGCCGCGTGCTCGCTACTTATAGCCTCTACGTGCCCTTCCTGGCTCTCAACGGCCTGGCTGAG
GCTTTCGTCGCCTCGGTTGCCACTGAGCGTCATCTTCGCCGCCAGTCTTTGGCAATGGCAGTCTTTAGCATCGTC
TTTGCCGTCGCTGCTGGTCTTCTCATGCGCGTCTTGGGCTGGGGTGCTCATGGGCTCGTCGTCGCTAACATGGTT
AACCTGCTGTGTCGCATCTGCTGGTGCGCCGTCTTCATCAAGGACTATTTTGGTCGTCGGAGCCACGCCTTTTCC
CTGACGGCTTTATTTCCTCGTCACGCATTTGCCGCCGCCTCTGCAATTGCTGCTGTTCTCGTCCGCTTGCGTCTT
CACCATGGCGCAGAGTCTGAGCCGATCCGAACTCTTGCCATGGTTGCTGCTTGGGCCATTCCTCTGCTCGCCATC
ACGTACGTTTATTCTTCTCTTCTCTATCTTTTGTGGTATCGACGCCATTTTCACCCAAAGTGAAACTGACAAAAG
CACATGAGCAGAGCCTTCTTGGAGAGAGACTTGCTGCTTCAATGTCTGCACTCCGTCCGCGGGAAAGAGGCCAGC
AAGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail