Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02529
Gene name
Locationscaffold_02:4008209..4009955
Strand+
Gene length (bp)1746
Transcript length (bp)1746
Coding sequence length (bp)1746
Protein length (aa) 582

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03055 RPE65 Retinal pigment epithelial membrane protein 2.1E-113 42 577

GO

GO Term Description Terminal node
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Yes
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0051213 dioxygenase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5682 0.2291 0.1266 0.277 0.3337 0.2161 0.1605 0.1132 0.07 0.0203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3094
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7369
Ophiocordyceps australis map64 (Brazil) OphauB2|7572
Ophiocordyceps camponoti-floridani Ophcf2|02529 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4184
Ophiocordyceps kimflemingae Ophio5|5612
Ophiocordyceps subramaniannii Hirsu2|5391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02529
MDTVGVVRRGPEHQDSDVAATIDRLKDGAWRWWPNRAGFEGLVEHRGPIRLRVRGEIPPWAAGSLFRTGPGQSTV
EGTVRGTHYVSHWFDGFAHTHRFDIVEEDDDGGKTVAVIYSSRRQSDAHVEHIRREGWRSSTSFGQRADPCIGIF
AKLMSFFIPRRINTNVVCNPNYPGLPRTAPDDGADSAAPSTLASRRTGVSSIFISTDHCSLQEISPDTLEPLGFT
NQRGLHPDLGGPMSCAHSQRDPVTGDVFNYNLALGRLATYRVFRVNAADGSTDILATLSEPDIPPAYMHSFFLTE
NYVVLCIPSAHFAWNGLKILWRRNLLDAIKPFDAQQHCIWLVVDRRHGRGLVCRFTTPAAFYFHTVNAFEERVEE
DGDDEATVHLNLDAVFYDNTDVIFALYYDVILDRDDAMSNFVRDGRFLSARNRLVRHRFRMPKVTDSPPPPHQAQ
EIFSIPNPHSGELSSINPAYAGRRHRYVFGTSTRGLSTLMDTIVKTDLDTRQVLFWAGPWGHTPGEPIFVARPGA
TAEDDGVLLSVVLDGAAKRSYLLCLDARTLVEMGRAETDFAIAIGFHGFHAPVLKP*
Coding >Ophcf2|02529
ATGGACACGGTCGGCGTCGTCCGGCGCGGCCCCGAACACCAAGACTCGGACGTGGCCGCCACCATCGACCGGCTC
AAGGACGGTGCCTGGCGATGGTGGCCCAACCGTGCCGGCTTCGAGGGCCTGGTCGAACACCGGGGGCCCATCCGG
CTGCGAGTCCGCGGCGAGATTCCCCCTTGGGCTGCCGGATCGCTCTTCCGAACGGGTCCCGGGCAGAGTACGGTG
GAGGGGACGGTCAGGGGAACGCACTACGTCTCGCACTGGTTCGATGGCTTTGCTCATACGCACCGCTTCGACATT
GTCGAGGAGGATGACGACGGGGGGAAGACGGTGGCGGTGATATACTCTTCCCGTCGTCAGTCCGACGCTCACGTC
GAACATATCCGTCGTGAGGGCTGGCGATCGAGCACCTCGTTCGGCCAACGAGCAGATCCCTGCATCGGAATCTTC
GCCAAGTTGATGAGCTTCTTCATCCCCCGCCGCATCAACACCAACGTCGTCTGCAATCCCAACTATCCAGGCCTC
CCCCGGACGGCCCCCGACGACGGAGCCGACTCGGCAGCCCCGTCCACGCTGGCCAGCCGTCGTACGGGCGTGTCC
TCCATCTTCATCAGCACGGATCACTGCAGCTTGCAGGAGATAAGCCCGGATACGCTCGAGCCGTTGGGCTTCACG
AATCAGCGGGGGCTTCATCCGGATCTCGGCGGGCCCATGTCCTGTGCGCATTCGCAGCGGGATCCGGTCACGGGC
GACGTCTTTAATTATAACCTTGCGCTGGGACGACTGGCTACGTATCGCGTCTTCCGCGTCAACGCCGCGGATGGG
TCGACGGATATCCTGGCCACCTTGTCGGAGCCGGACATCCCGCCGGCGTATATGCATAGCTTCTTCCTGACGGAG
AACTACGTCGTTCTATGCATTCCGTCGGCGCACTTCGCCTGGAACGGGCTGAAGATTCTGTGGCGTAGGAATCTC
CTCGACGCCATCAAGCCGTTTGATGCCCAGCAGCATTGCATATGGCTCGTGGTTGATCGTCGTCACGGTCGCGGT
CTGGTCTGTCGTTTCACCACCCCCGCTGCTTTTTACTTTCACACCGTCAACGCCTTTGAGGAACGCGTCGAGGAG
GACGGAGATGACGAGGCAACGGTCCATCTCAACTTGGACGCCGTCTTTTACGATAACACCGACGTCATCTTCGCT
CTTTACTACGACGTCATCCTCGATCGCGACGATGCCATGTCAAACTTCGTTCGAGACGGCCGCTTCCTAAGCGCA
CGTAACCGACTCGTCCGCCACCGCTTCCGAATGCCAAAGGTCACCGACTCCCCCCCCCCCCCCCACCAAGCCCAA
GAGATCTTCTCCATCCCGAACCCTCACTCGGGCGAGCTCTCATCCATCAACCCGGCCTACGCAGGCCGTCGCCAC
CGCTACGTCTTCGGCACCAGCACCCGCGGCCTCAGCACCCTGATGGACACCATCGTCAAGACCGACCTCGATACC
CGACAGGTGCTCTTCTGGGCGGGACCGTGGGGACATACCCCCGGCGAGCCCATCTTCGTCGCTCGTCCCGGCGCG
ACGGCGGAGGACGACGGCGTGCTGTTGAGCGTCGTGCTGGACGGGGCGGCCAAGAGGTCGTATCTCTTGTGCTTG
GATGCCAGGACTCTGGTGGAGATGGGAAGGGCGGAGACGGACTTTGCCATTGCCATTGGCTTTCACGGCTTTCAT
GCTCCGGTCCTGAAGCCTTGA
Transcript >Ophcf2|02529
ATGGACACGGTCGGCGTCGTCCGGCGCGGCCCCGAACACCAAGACTCGGACGTGGCCGCCACCATCGACCGGCTC
AAGGACGGTGCCTGGCGATGGTGGCCCAACCGTGCCGGCTTCGAGGGCCTGGTCGAACACCGGGGGCCCATCCGG
CTGCGAGTCCGCGGCGAGATTCCCCCTTGGGCTGCCGGATCGCTCTTCCGAACGGGTCCCGGGCAGAGTACGGTG
GAGGGGACGGTCAGGGGAACGCACTACGTCTCGCACTGGTTCGATGGCTTTGCTCATACGCACCGCTTCGACATT
GTCGAGGAGGATGACGACGGGGGGAAGACGGTGGCGGTGATATACTCTTCCCGTCGTCAGTCCGACGCTCACGTC
GAACATATCCGTCGTGAGGGCTGGCGATCGAGCACCTCGTTCGGCCAACGAGCAGATCCCTGCATCGGAATCTTC
GCCAAGTTGATGAGCTTCTTCATCCCCCGCCGCATCAACACCAACGTCGTCTGCAATCCCAACTATCCAGGCCTC
CCCCGGACGGCCCCCGACGACGGAGCCGACTCGGCAGCCCCGTCCACGCTGGCCAGCCGTCGTACGGGCGTGTCC
TCCATCTTCATCAGCACGGATCACTGCAGCTTGCAGGAGATAAGCCCGGATACGCTCGAGCCGTTGGGCTTCACG
AATCAGCGGGGGCTTCATCCGGATCTCGGCGGGCCCATGTCCTGTGCGCATTCGCAGCGGGATCCGGTCACGGGC
GACGTCTTTAATTATAACCTTGCGCTGGGACGACTGGCTACGTATCGCGTCTTCCGCGTCAACGCCGCGGATGGG
TCGACGGATATCCTGGCCACCTTGTCGGAGCCGGACATCCCGCCGGCGTATATGCATAGCTTCTTCCTGACGGAG
AACTACGTCGTTCTATGCATTCCGTCGGCGCACTTCGCCTGGAACGGGCTGAAGATTCTGTGGCGTAGGAATCTC
CTCGACGCCATCAAGCCGTTTGATGCCCAGCAGCATTGCATATGGCTCGTGGTTGATCGTCGTCACGGTCGCGGT
CTGGTCTGTCGTTTCACCACCCCCGCTGCTTTTTACTTTCACACCGTCAACGCCTTTGAGGAACGCGTCGAGGAG
GACGGAGATGACGAGGCAACGGTCCATCTCAACTTGGACGCCGTCTTTTACGATAACACCGACGTCATCTTCGCT
CTTTACTACGACGTCATCCTCGATCGCGACGATGCCATGTCAAACTTCGTTCGAGACGGCCGCTTCCTAAGCGCA
CGTAACCGACTCGTCCGCCACCGCTTCCGAATGCCAAAGGTCACCGACTCCCCCCCCCCCCCCCACCAAGCCCAA
GAGATCTTCTCCATCCCGAACCCTCACTCGGGCGAGCTCTCATCCATCAACCCGGCCTACGCAGGCCGTCGCCAC
CGCTACGTCTTCGGCACCAGCACCCGCGGCCTCAGCACCCTGATGGACACCATCGTCAAGACCGACCTCGATACC
CGACAGGTGCTCTTCTGGGCGGGACCGTGGGGACATACCCCCGGCGAGCCCATCTTCGTCGCTCGTCCCGGCGCG
ACGGCGGAGGACGACGGCGTGCTGTTGAGCGTCGTGCTGGACGGGGCGGCCAAGAGGTCGTATCTCTTGTGCTTG
GATGCCAGGACTCTGGTGGAGATGGGAAGGGCGGAGACGGACTTTGCCATTGCCATTGGCTTTCACGGCTTTCAT
GCTCCGGTCCTGAAGCCTTGA
Gene >Ophcf2|02529
ATGGACACGGTCGGCGTCGTCCGGCGCGGCCCCGAACACCAAGACTCGGACGTGGCCGCCACCATCGACCGGCTC
AAGGACGGTGCCTGGCGATGGTGGCCCAACCGTGCCGGCTTCGAGGGCCTGGTCGAACACCGGGGGCCCATCCGG
CTGCGAGTCCGCGGCGAGATTCCCCCTTGGGCTGCCGGATCGCTCTTCCGAACGGGTCCCGGGCAGAGTACGGTG
GAGGGGACGGTCAGGGGAACGCACTACGTCTCGCACTGGTTCGATGGCTTTGCTCATACGCACCGCTTCGACATT
GTCGAGGAGGATGACGACGGGGGGAAGACGGTGGCGGTGATATACTCTTCCCGTCGTCAGTCCGACGCTCACGTC
GAACATATCCGTCGTGAGGGCTGGCGATCGAGCACCTCGTTCGGCCAACGAGCAGATCCCTGCATCGGAATCTTC
GCCAAGTTGATGAGCTTCTTCATCCCCCGCCGCATCAACACCAACGTCGTCTGCAATCCCAACTATCCAGGCCTC
CCCCGGACGGCCCCCGACGACGGAGCCGACTCGGCAGCCCCGTCCACGCTGGCCAGCCGTCGTACGGGCGTGTCC
TCCATCTTCATCAGCACGGATCACTGCAGCTTGCAGGAGATAAGCCCGGATACGCTCGAGCCGTTGGGCTTCACG
AATCAGCGGGGGCTTCATCCGGATCTCGGCGGGCCCATGTCCTGTGCGCATTCGCAGCGGGATCCGGTCACGGGC
GACGTCTTTAATTATAACCTTGCGCTGGGACGACTGGCTACGTATCGCGTCTTCCGCGTCAACGCCGCGGATGGG
TCGACGGATATCCTGGCCACCTTGTCGGAGCCGGACATCCCGCCGGCGTATATGCATAGCTTCTTCCTGACGGAG
AACTACGTCGTTCTATGCATTCCGTCGGCGCACTTCGCCTGGAACGGGCTGAAGATTCTGTGGCGTAGGAATCTC
CTCGACGCCATCAAGCCGTTTGATGCCCAGCAGCATTGCATATGGCTCGTGGTTGATCGTCGTCACGGTCGCGGT
CTGGTCTGTCGTTTCACCACCCCCGCTGCTTTTTACTTTCACACCGTCAACGCCTTTGAGGAACGCGTCGAGGAG
GACGGAGATGACGAGGCAACGGTCCATCTCAACTTGGACGCCGTCTTTTACGATAACACCGACGTCATCTTCGCT
CTTTACTACGACGTCATCCTCGATCGCGACGATGCCATGTCAAACTTCGTTCGAGACGGCCGCTTCCTAAGCGCA
CGTAACCGACTCGTCCGCCACCGCTTCCGAATGCCAAAGGTCACCGACTCCCCCCCCCCCCCCCACCAAGCCCAA
GAGATCTTCTCCATCCCGAACCCTCACTCGGGCGAGCTCTCATCCATCAACCCGGCCTACGCAGGCCGTCGCCAC
CGCTACGTCTTCGGCACCAGCACCCGCGGCCTCAGCACCCTGATGGACACCATCGTCAAGACCGACCTCGATACC
CGACAGGTGCTCTTCTGGGCGGGACCGTGGGGACATACCCCCGGCGAGCCCATCTTCGTCGCTCGTCCCGGCGCG
ACGGCGGAGGACGACGGCGTGCTGTTGAGCGTCGTGCTGGACGGGGCGGCCAAGAGGTCGTATCTCTTGTGCTTG
GATGCCAGGACTCTGGTGGAGATGGGAAGGGCGGAGACGGACTTTGCCATTGCCATTGGCTTTCACGGCTTTCAT
GCTCCGGTCCTGAAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail