Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02517
Gene name
Locationscaffold_02:3975200..3975982
Strand+
Gene length (bp)782
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 3.6E-04 7 23
PF00098 zf-CCHC Zinc knuckle 2.4E-03 28 43
PF00098 zf-CCHC Zinc knuckle 3.4E-05 52 67
PF00098 zf-CCHC Zinc knuckle 2.9E-08 79 94
PF00098 zf-CCHC Zinc knuckle 8.4E-07 127 142
PF00098 zf-CCHC Zinc knuckle 2.3E-07 147 162
PF00098 zf-CCHC Zinc knuckle 6.9E-08 174 191
PF14392 zf-CCHC_4 Zinc knuckle 2.5E-01 6 23
PF14392 zf-CCHC_4 Zinc knuckle 1.6E+00 27 43
PF14392 zf-CCHC_4 Zinc knuckle 3.7E+00 53 67
PF14392 zf-CCHC_4 Zinc knuckle 1.7E+00 80 94
PF14392 zf-CCHC_4 Zinc knuckle 6.0E-01 148 162
PF14392 zf-CCHC_4 Zinc knuckle 8.3E-01 174 190

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5449 0.4943 0.1044 0.0703 0.1419 0.004 0.0905 0.0945 0.0677 0.0

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4335
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4111
Ophiocordyceps australis map64 (Brazil) OphauB2|3148
Ophiocordyceps camponoti-floridani Ophcf2|02517 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|783
Ophiocordyceps kimflemingae Ophio5|7062
Ophiocordyceps subramaniannii Hirsu2|8906

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02517
MSSLSRRACYKCGNVGHYAEVCSSAERLCYNCKQPGHESNGCPLPRTTEAKQCYHCQGLGHVQADCPTLRLTGNP
TSGRCYNCGQPGHLARMCPAAAMGRGAPMMPRGGYAPAFNRGAFAGGPRPATCYKCGGPNHFARDCQAQAMKCYA
CGKLGHISRDCTAPNGGPLSTVGKTCYQCGEAGHISRDCPQKNANGEMPPEVDMSTVPAAPAPVAPIAPVA*
Coding >Ophcf2|02517
ATGTCTTCGCTATCTCGTCGTGCCTGCTACAAATGCGGCAATGTCGGACACTACGCCGAGGTCTGCTCATCGGCT
GAGCGGCTCTGCTACAACTGCAAGCAACCCGGCCACGAGTCCAACGGCTGCCCGCTGCCGCGCACCACCGAGGCC
AAGCAGTGCTACCACTGCCAGGGCTTGGGCCATGTCCAGGCCGACTGTCCGACGCTTCGTCTGACTGGGAACCCG
ACCAGTGGCCGCTGCTACAACTGCGGCCAGCCTGGTCATCTCGCGCGCATGTGTCCTGCTGCTGCCATGGGCCGT
GGAGCCCCCATGATGCCCCGTGGCGGATATGCCCCGGCCTTCAACCGCGGCGCCTTCGCGGGCGGTCCCCGTCCG
GCCACCTGCTACAAGTGCGGAGGGCCCAATCACTTCGCACGCGACTGTCAGGCTCAGGCCATGAAGTGCTACGCT
TGCGGCAAGCTGGGCCACATCTCCCGCGACTGCACCGCCCCCAATGGCGGCCCCTTGAGCACTGTCGGCAAGACG
TGCTACCAATGCGGCGAGGCCGGCCACATCTCGAGAGACTGTCCGCAGAAGAACGCCAACGGCGAGATGCCTCCC
GAGGTCGATATGAGCACCGTCCCGGCTGCGCCAGCTCCCGTGGCTCCCATCGCCCCTGTGGCGTAG
Transcript >Ophcf2|02517
ATGTCTTCGCTATCTCGTCGTGCCTGCTACAAATGCGGCAATGTCGGACACTACGCCGAGGTCTGCTCATCGGCT
GAGCGGCTCTGCTACAACTGCAAGCAACCCGGCCACGAGTCCAACGGCTGCCCGCTGCCGCGCACCACCGAGGCC
AAGCAGTGCTACCACTGCCAGGGCTTGGGCCATGTCCAGGCCGACTGTCCGACGCTTCGTCTGACTGGGAACCCG
ACCAGTGGCCGCTGCTACAACTGCGGCCAGCCTGGTCATCTCGCGCGCATGTGTCCTGCTGCTGCCATGGGCCGT
GGAGCCCCCATGATGCCCCGTGGCGGATATGCCCCGGCCTTCAACCGCGGCGCCTTCGCGGGCGGTCCCCGTCCG
GCCACCTGCTACAAGTGCGGAGGGCCCAATCACTTCGCACGCGACTGTCAGGCTCAGGCCATGAAGTGCTACGCT
TGCGGCAAGCTGGGCCACATCTCCCGCGACTGCACCGCCCCCAATGGCGGCCCCTTGAGCACTGTCGGCAAGACG
TGCTACCAATGCGGCGAGGCCGGCCACATCTCGAGAGACTGTCCGCAGAAGAACGCCAACGGCGAGATGCCTCCC
GAGGTCGATATGAGCACCGTCCCGGCTGCGCCAGCTCCCGTGGCTCCCATCGCCCCTGTGGCGTAG
Gene >Ophcf2|02517
ATGTCTTCGCTATCTCGTCGTGCCTGCTACAAATGCGGCAATGTCGGACACTACGCCGAGGTCTGCTCATCGGCT
GAGCGGCTCTGCTACAACTGCAAGTTCTCCTCCCGATCCTTATCGCTGGCCCGACCGGCTGACCTCGTTGCCCCA
GGCAAGCAACCCGGCCACGAGTCCAACGGCTGCCCGCTGCCGCGCACCACCGAGGCCAAGCAGTGCTACCACTGC
CAGGGCTTGGGCCATGTCCAGGCCGACTGTCCGACGCTTCGTCTGACTGGGAACCCGACCAGTGGCCGCTGCTAC
AACTGCGGCCAGCCTGGTCATCTCGCGGTACGCCGACTCGCCTACCCGATGCGCATTGCTTGGCTAACTTACTCT
CGTTCCCTCAGCGCATGTGTCCTGCTGCTGCCATGGGCCGTGGAGCCCCCATGATGCCCCGTGGCGGATATGCCC
CGGCCTTCAACCGCGGCGCCTTCGCGGGCGGTCCCCGTCCGGCCACCTGCTACAAGTGCGGAGGGCCCAATCACT
TCGCACGCGACTGTCAGGCTCAGGCCATGAAGTGCTACGCTTGCGGCAAGCTGGGCCACATCTCCCGCGACTGCA
CCGCCCCCAATGGCGGCCCCTTGAGCACTGTCGGCAAGACGTGCTACCAATGCGGCGAGGCCGGCCACATCTCGA
GAGACTGTCCGCAGAAGAACGCCAACGGCGAGATGCCTCCCGAGGTCGATATGAGCACCGTCCCGGCTGCGCCAG
CTCCCGTGGCTCCCATCGCCCCTGTGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail