Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02506
Gene name
Locationscaffold_02:3941493..3943112
Strand+
Gene length (bp)1619
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02116 STE2 Fungal pheromone mating factor STE2 GPCR 1.8E-74 71 354

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0004930 G protein-coupled receptor activity No
GO:0038023 signaling receptor activity No
GO:0050794 regulation of cellular process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008528 G protein-coupled peptide receptor activity No
GO:0060089 molecular transducer activity No
GO:0005575 cellular_component No
GO:0004888 transmembrane signaling receptor activity No
GO:0003674 molecular_function No
GO:0007165 signal transduction No
GO:0016503 pheromone receptor activity No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0001653 peptide receptor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 143 165 22
3 180 199 19
4 220 242 22
5 257 279 22
6 300 322 22
7 337 359 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 2.36 0.44 4.27
Alive In ants, during behavior modification 0.16 0.00 0.44
Dead In ants, recently dead 0.24 0.00 0.60

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.006027 yes
Alive Dead 1.000000 no
Dead Fungus 0.003275 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02506
MGDFNRVADFDCLVGQSIFGFCGGSLPSSSSNLQVLDKASPQRRQKPPTSSMKPSGASFLGEYPPKPEPGFDPAD
QTLAFFARDGQTVIGVPMTTIDDFNAESISMGITSGAEIGACLIILAALIVLTPLAKLRRPTAACQIMALILCLT
RAAFEISDLFTPIFHFYVYWAGDYTGVPRGYIYRGIAGHVVTMLVNMAVEMTLMNQAWTMVSLFSARLRLWLTLV
SALVVLVVVGLRIAFAVMLSQVDVVSGPRSSLVWIMQATLISNTVSIFWFCALFNSKLVLHIIANRGILSSSSRK
LSSMEVLVMTNGVLMVIPVIFAGLEYGSFRNFEPARLTIATVAVILPLGTLAAQRISALTSSKASDREADSTGSK
QSGTGPCNLRKQSMSSSSASPFSKCERGRGSVRAGATRVEDPYDLELRRIDSTGFSGILIDQKLEQRYESV*
Coding >Ophcf2|02506
ATGGGCGACTTCAATCGGGTAGCGGACTTTGATTGCCTGGTAGGACAGTCGATTTTCGGCTTCTGTGGCGGGAGC
CTTCCGTCCTCATCTTCCAACCTTCAAGTCCTCGATAAAGCCTCACCACAGCGACGGCAAAAACCGCCAACATCA
AGCATGAAGCCCTCCGGAGCCTCTTTTCTCGGCGAATACCCTCCCAAGCCCGAGCCAGGTTTCGACCCAGCAGAC
CAGACGCTGGCCTTTTTCGCCCGAGACGGCCAGACGGTCATCGGGGTGCCCATGACCACCATCGACGACTTCAAC
GCAGAGTCCATCAGCATGGGCATCACCAGCGGCGCCGAGATAGGAGCCTGCCTCATCATTCTCGCCGCGCTTATC
GTCCTCACGCCCCTTGCCAAGCTGCGGCGACCGACGGCCGCGTGCCAGATAATGGCTCTTATCCTTTGCCTTACC
CGCGCCGCCTTTGAGATTTCAGACCTTTTCACGCCCATCTTTCACTTTTACGTCTACTGGGCCGGCGATTATACC
GGTGTTCCGCGCGGATACATCTACAGGGGCATCGCCGGCCACGTCGTCACCATGCTCGTCAACATGGCCGTCGAG
ATGACGCTGATGAACCAGGCCTGGACCATGGTTTCGCTCTTTTCGGCCAGGCTGAGGTTGTGGCTGACGCTCGTC
TCGGCTCTCGTCGTCTTGGTGGTTGTCGGGCTGCGCATTGCTTTCGCCGTCATGCTGAGCCAAGTCGATGTTGTG
TCTGGTCCGAGGTCGTCTTTGGTCTGGATAATGCAGGCTACCCTCATCTCCAACACCGTTTCCATCTTCTGGTTC
TGCGCCCTTTTCAACTCCAAGCTGGTTCTTCACATCATTGCCAACCGCGGTATCCTGTCGTCTTCGAGCCGCAAG
CTGAGCTCCATGGAAGTTCTCGTCATGACCAACGGAGTTCTCATGGTCATCCCAGTCATCTTCGCCGGCCTCGAA
TACGGCAGCTTCCGCAACTTCGAACCAGCCCGACTGACGATAGCCACCGTCGCCGTCATTCTTCCCCTGGGAACT
CTCGCCGCCCAGCGGATCAGCGCGCTAACCAGCAGCAAGGCCTCAGACCGCGAAGCCGATTCCACCGGGAGCAAG
CAGTCCGGAACCGGCCCCTGCAACCTCAGGAAGCAGAGCATGTCCAGCAGCTCGGCTTCGCCCTTTTCCAAGTGC
GAGCGCGGTAGGGGCAGTGTCCGTGCCGGCGCAACGCGTGTCGAGGATCCGTATGATCTAGAGCTTCGCCGCATT
GATTCTACCGGCTTTTCTGGTATTCTCATCGACCAGAAGCTGGAGCAGCGGTACGAGAGCGTCTAG
Transcript >Ophcf2|02506
ATGGGCGACTTCAATCGGGTAGCGGACTTTGATTGCCTGGTAGGACAGTCGATTTTCGGCTTCTGTGGCGGGAGC
CTTCCGTCCTCATCTTCCAACCTTCAAGTCCTCGATAAAGCCTCACCACAGCGACGGCAAAAACCGCCAACATCA
AGCATGAAGCCCTCCGGAGCCTCTTTTCTCGGCGAATACCCTCCCAAGCCCGAGCCAGGTTTCGACCCAGCAGAC
CAGACGCTGGCCTTTTTCGCCCGAGACGGCCAGACGGTCATCGGGGTGCCCATGACCACCATCGACGACTTCAAC
GCAGAGTCCATCAGCATGGGCATCACCAGCGGCGCCGAGATAGGAGCCTGCCTCATCATTCTCGCCGCGCTTATC
GTCCTCACGCCCCTTGCCAAGCTGCGGCGACCGACGGCCGCGTGCCAGATAATGGCTCTTATCCTTTGCCTTACC
CGCGCCGCCTTTGAGATTTCAGACCTTTTCACGCCCATCTTTCACTTTTACGTCTACTGGGCCGGCGATTATACC
GGTGTTCCGCGCGGATACATCTACAGGGGCATCGCCGGCCACGTCGTCACCATGCTCGTCAACATGGCCGTCGAG
ATGACGCTGATGAACCAGGCCTGGACCATGGTTTCGCTCTTTTCGGCCAGGCTGAGGTTGTGGCTGACGCTCGTC
TCGGCTCTCGTCGTCTTGGTGGTTGTCGGGCTGCGCATTGCTTTCGCCGTCATGCTGAGCCAAGTCGATGTTGTG
TCTGGTCCGAGGTCGTCTTTGGTCTGGATAATGCAGGCTACCCTCATCTCCAACACCGTTTCCATCTTCTGGTTC
TGCGCCCTTTTCAACTCCAAGCTGGTTCTTCACATCATTGCCAACCGCGGTATCCTGTCGTCTTCGAGCCGCAAG
CTGAGCTCCATGGAAGTTCTCGTCATGACCAACGGAGTTCTCATGGTCATCCCAGTCATCTTCGCCGGCCTCGAA
TACGGCAGCTTCCGCAACTTCGAACCAGCCCGACTGACGATAGCCACCGTCGCCGTCATTCTTCCCCTGGGAACT
CTCGCCGCCCAGCGGATCAGCGCGCTAACCAGCAGCAAGGCCTCAGACCGCGAAGCCGATTCCACCGGGAGCAAG
CAGTCCGGAACCGGCCCCTGCAACCTCAGGAAGCAGAGCATGTCCAGCAGCTCGGCTTCGCCCTTTTCCAAGTGC
GAGCGCGGTAGGGGCAGTGTCCGTGCCGGCGCAACGCGTGTCGAGGATCCGTATGATCTAGAGCTTCGCCGCATT
GATTCTACCGGCTTTTCTGGTATTCTCATCGACCAGAAGCTGGAGCAGCGGTACGAGAGCGTCTAG
Gene >Ophcf2|02506
ATGGGCGACTTCAATCGGGTAGCGGACTTTGATTGCCTGGTAGGACAGTCGATTTTCGGCTTCTGTGGCGGGAGG
TTAGTGTTGTCCTCTTCTACTTGTTTTCTGCATGAGACGTATGACTTTCTCTGTGGTTTTCTTGTCTCTACGTCT
GTGTATGAGCGTGCAAAGTTCAATGCCAGGTGCTTCCTATTATCCCCCTTCCCCCCCATTCCTCTGCCTCTCCCA
CCTCCTCACTCCCCTTTTCGAAACCAAAAACGCTAATCTCTCGATTCCAAAAATCTCCCGCTCTGCAGCCTTCCG
TCCTCATCTTCCAACCTTCAAGTCCTCGATAAAGCCTCACCACAGCGACGGCAAAAACCGCCAACATCAAGCATG
AAGCCCTCCGGAGCCTCTTTTCTCGGCGAATACCCTCCCAAGCCCGAGCCAGGTTTCGACCCAGCAGACCAGACG
CTGGCCTTTTTCGCCCGAGACGGCCAGACGGTCATCGGGGTGCCCATGACCACCATCGACGACTTCAACGCAGAG
TCCATCAGCATGGGCATCACCAGCGGCGCCGAGATAGGAGCCTGCCTCATCATTCTCGCCGCGCTTATCGTCCTC
ACGCCCCTTGCCAAGCTGCGGCGACCGACGGCCGCGTGCCAGATAATGGCTCTTATCCTTTGCCTTACCCGCGCC
GCCTTTGAGATTTCAGACCTTTTCACGCCCATCTTTCACTTTTACGTCTACTGGGCCGGCGATTATACCGGTGTT
CCGCGCGGATACATCTACAGGGGCATCGCCGGCCACGTCGTCACCATGCTCGTCAACATGGCCGTCGAGATGACG
CTGATGAACCAGGCCTGGACCATGGTTTCGCTCTTTTCGGCCAGGCTGAGGTTGTGGCTGACGCTCGTCTCGGCT
CTCGTCGTCTTGGTGGTTGTCGGGCTGCGCATTGCTTTCGCCGTCATGCTGAGCCAAGTCGATGTTGTGTCTGGT
CCGAGGTCGTCTTTGGTCTGGATAATGCAGGCTACCCTCATCTCCAACACCGTTTCCATCTTCTGGTTCTGCGCC
CTTTTCAACTCCAAGCTGGTTCTTCACATCATTGCCAACCGCGGTATCCTGTCGTCTTCGAGCCGCAAGCTGAGC
TCCATGGAAGTTCTCGTCATGACCAACGGAGTTCTCATGGTCATCCCAGGTGAGTCCCCAATCTCCTTTGATATC
TCGTTGAAATCTAGTTACTTATGAATCTCTCAGTCATCTTCGCCGGCCTCGAATACGGCAGCTTCCGCAACTTCG
AACCAGCCCGACTGACGATAGCCACCGTCGCCGTCATTCTTCCCCTGGGAACTCTCGCCGCCCAGCGGATCAGCG
CGCTAACCAGCAGCAAGGCCTCAGACCGCGAAGCCGATTCCACCGGGAGCAAGCAGTCCGGAACCGGCCCCTGCA
ACCTCAGGAAGCAGAGCATGTCCAGCAGCTCGGCTTCGCCCTTTTCCAAGTGCGAGCGCGGTAGGGGCAGTGTCC
GTGCCGGCGCAACGCGTGTCGAGGATCCGTATGATCTAGAGCTTCGCCGCATTGATTCTACCGGCTTTTCTGGTA
TTCTCATCGACCAGAAGCTGGAGCAGCGGTACGAGAGCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail