Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02502
Gene name
Locationscaffold_02:3930882..3931240
Strand+
Gene length (bp)358
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15786 PET117 PET assembly of cytochrome c oxidase, mitochondrial 3.6E-24 4 69

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02502
MSRASKLTLGATSIFAVATVVFVHFQQKAEQAAMHQGVVLDMERQRIKRERQQDFDTQRALELEYKRHQDVHESP
VEPEAKNPPQSPSP*
Coding >Ophcf2|02502
ATGTCCCGCGCCTCCAAGCTGACTCTCGGCGCAACTTCCATCTTCGCAGTCGCCACCGTCGTCTTCGTTCACTTC
CAGCAGAAAGCAGAGCAGGCCGCAATGCACCAAGGCGTAGTCCTCGACATGGAAAGACAGCGTATCAAGCGCGAG
CGCCAACAAGACTTCGACACTCAGCGCGCCCTCGAGCTCGAGTATAAGCGTCACCAAGACGTTCACGAGTCCCCC
GTCGAGCCCGAAGCCAAGAACCCGCCACAATCGCCGTCACCGTAG
Transcript >Ophcf2|02502
ATGTCCCGCGCCTCCAAGCTGACTCTCGGCGCAACTTCCATCTTCGCAGTCGCCACCGTCGTCTTCGTTCACTTC
CAGCAGAAAGCAGAGCAGGCCGCAATGCACCAAGGCGTAGTCCTCGACATGGAAAGACAGCGTATCAAGCGCGAG
CGCCAACAAGACTTCGACACTCAGCGCGCCCTCGAGCTCGAGTATAAGCGTCACCAAGACGTTCACGAGTCCCCC
GTCGAGCCCGAAGCCAAGAACCCGCCACAATCGCCGTCACCGTAG
Gene >Ophcf2|02502
ATGTCCCGCGCCTCCAAGCTGACTCTCGGCGCAACTTCCATCTTCGCAGTCGCCACCGTCGTCTTCGTTCACTTC
CAGCAGAAAGCAGAGCAGGCCGTACGTCCGCCCATCCCCCAGCTCTCTTGTCCCATGTCCATCTCTCTCCTTGCC
TCTCTTCTCTCTCGCGAACCTAATGAGAATACAGGCAATGCACCAAGGCGTAGTCCTCGACATGGAAAGACAGCG
TATCAAGCGCGAGCGCCAACAAGACTTCGACACTCAGCGCGCCCTCGAGCTCGAGTATAAGCGTCACCAAGACGT
TCACGAGTCCCCCGTCGAGCCCGAAGCCAAGAACCCGCCACAATCGCCGTCACCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail