Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02498
Gene name
Locationscaffold_02:3921782..3923705
Strand+
Gene length (bp)1923
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08216 CTNNBL Catenin-beta-like, Arm-motif containing nuclear 1.7E-174 93 559

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3483 0.8815 0.1068 0.0166 0.0437 0.0014 0.0302 0.0116 0.0692 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1523
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3642
Ophiocordyceps australis map64 (Brazil) OphauB2|5430
Ophiocordyceps camponoti-floridani Ophcf2|02498 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1346
Ophiocordyceps kimflemingae Ophio5|2671
Ophiocordyceps subramaniannii Hirsu2|11203

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02498
MASVDDIFKNVGLPSKRKREAIADPNEFYKSSKLSASSHRKRNEAEADSTAADDDDELEAGPASPPHQGEADEEG
DDDEGRFFGGGITAKESEVLDFVAGLGEDADRGPEKIDVAWMRRTAQTLEKRIATNTRLRAKHEGEPQKFIASEA
ELDADVKALSILSEHPELYPDFVALGCAVHLVGLLAHDNTDIAIDALEIIGELTDEDVAADDSQWDALVDALLDA
DLIGLLVSNLARLDEADEADRNGVYYALGIVENLCSRSSTAARIGAHDALLGWLLQRIQRQEQPITVSQNKQYAA
EILAILSQSSAEIRRQMAARDAIDIMLQLVAVYRKRDPDKGGEEEEYMENLFEALTCLVDEPSGKAKFIEAEGVE
LCLIMFKEGKRSKAPALRLMDHAAGGASASAVDVCVKLVDAGGLRPLFTLFIKSRDRRLQGHMLGVLASMMRLLP
AGSAERIRTLAKFVEKDYEKTAKLVQLHVDFAALVGRAEAQYRRNAAGVDPADADVELLSRRLDAGLFALQQVDV
LLAWLAAEDGGARKRVEQLLADRDESLATVAAIIKEQREALDTTEEDSKDMSDMLDTLLEFVR*
Coding >Ophcf2|02498
ATGGCCAGCGTCGACGACATCTTCAAGAACGTCGGCCTGCCTAGCAAGCGAAAACGAGAAGCCATCGCCGATCCA
AACGAATTCTATAAATCGAGCAAACTCAGCGCCTCAAGCCACCGAAAGCGCAACGAGGCCGAGGCTGATTCCACC
GCTGCCGACGACGATGACGAGCTCGAGGCCGGCCCCGCGTCGCCGCCACATCAGGGAGAAGCAGACGAGGAAGGC
GACGATGATGAAGGTCGCTTCTTCGGCGGCGGTATCACTGCGAAAGAGTCCGAGGTCCTCGACTTCGTAGCCGGC
CTTGGCGAGGACGCAGACCGAGGCCCCGAAAAGATTGACGTCGCCTGGATGCGCAGGACTGCTCAGACGCTGGAA
AAGCGCATCGCGACAAACACGCGACTCCGCGCCAAGCACGAGGGTGAGCCGCAAAAGTTCATCGCCAGCGAAGCC
GAACTCGACGCCGACGTGAAAGCCTTGTCTATCCTTTCTGAACACCCGGAGCTGTATCCCGACTTTGTCGCTCTC
GGCTGCGCCGTTCATCTCGTCGGCCTACTCGCTCATGATAATACCGACATCGCCATCGACGCCCTGGAAATCATT
GGCGAGCTGACGGACGAGGACGTCGCCGCCGACGACAGCCAGTGGGACGCTTTGGTCGACGCTCTGCTCGACGCC
GACCTGATCGGCCTGCTCGTCTCCAACCTGGCTCGCCTAGACGAAGCCGATGAGGCCGATCGCAACGGCGTCTAT
TACGCTCTCGGCATCGTCGAGAACCTCTGCTCACGCTCGTCCACAGCCGCTCGCATCGGAGCCCACGACGCCCTT
CTCGGCTGGCTGCTACAGCGCATCCAACGCCAGGAGCAGCCTATAACCGTCTCCCAAAACAAGCAATACGCGGCC
GAGATCCTCGCCATCCTCTCCCAATCCTCCGCCGAGATCCGCCGCCAGATGGCCGCCCGCGACGCCATCGACATC
ATGCTGCAGCTTGTCGCCGTCTACCGGAAACGCGACCCGGACAAGGGCGGCGAGGAGGAAGAGTACATGGAGAAT
CTCTTCGAAGCCCTCACCTGCCTCGTCGATGAGCCGTCGGGAAAGGCCAAGTTCATTGAGGCCGAGGGCGTCGAG
CTCTGCCTCATCATGTTCAAGGAGGGCAAGCGCAGCAAAGCCCCGGCCCTTCGCCTCATGGACCACGCCGCAGGG
GGCGCTTCAGCCTCTGCCGTCGACGTGTGCGTCAAGCTCGTCGACGCCGGCGGCCTGCGTCCCCTCTTCACCCTC
TTCATCAAGAGCCGCGACCGGCGCTTGCAGGGCCATATGCTCGGTGTGCTGGCGTCGATGATGCGCCTGCTGCCG
GCCGGCTCGGCCGAGAGGATCCGCACGCTGGCCAAGTTCGTGGAGAAGGACTACGAGAAGACGGCCAAGCTTGTG
CAGCTTCATGTCGACTTTGCCGCTCTTGTCGGGCGTGCCGAGGCTCAGTATCGTCGGAACGCCGCGGGGGTGGAC
CCGGCCGATGCAGATGTCGAGCTACTGTCACGGAGGCTCGATGCCGGGCTCTTCGCCCTGCAGCAGGTGGACGTC
TTGCTGGCCTGGTTGGCGGCCGAGGACGGAGGAGCGAGGAAACGGGTCGAGCAGTTGCTGGCAGACCGGGATGAG
AGCTTGGCTACTGTGGCGGCCATCATCAAGGAGCAGCGTGAGGCTTTGGATACCACCGAGGAGGACAGCAAGGAT
ATGAGCGATATGTTAGATACACTGCTGGAGTTTGTGCGGTAG
Transcript >Ophcf2|02498
ATGGCCAGCGTCGACGACATCTTCAAGAACGTCGGCCTGCCTAGCAAGCGAAAACGAGAAGCCATCGCCGATCCA
AACGAATTCTATAAATCGAGCAAACTCAGCGCCTCAAGCCACCGAAAGCGCAACGAGGCCGAGGCTGATTCCACC
GCTGCCGACGACGATGACGAGCTCGAGGCCGGCCCCGCGTCGCCGCCACATCAGGGAGAAGCAGACGAGGAAGGC
GACGATGATGAAGGTCGCTTCTTCGGCGGCGGTATCACTGCGAAAGAGTCCGAGGTCCTCGACTTCGTAGCCGGC
CTTGGCGAGGACGCAGACCGAGGCCCCGAAAAGATTGACGTCGCCTGGATGCGCAGGACTGCTCAGACGCTGGAA
AAGCGCATCGCGACAAACACGCGACTCCGCGCCAAGCACGAGGGTGAGCCGCAAAAGTTCATCGCCAGCGAAGCC
GAACTCGACGCCGACGTGAAAGCCTTGTCTATCCTTTCTGAACACCCGGAGCTGTATCCCGACTTTGTCGCTCTC
GGCTGCGCCGTTCATCTCGTCGGCCTACTCGCTCATGATAATACCGACATCGCCATCGACGCCCTGGAAATCATT
GGCGAGCTGACGGACGAGGACGTCGCCGCCGACGACAGCCAGTGGGACGCTTTGGTCGACGCTCTGCTCGACGCC
GACCTGATCGGCCTGCTCGTCTCCAACCTGGCTCGCCTAGACGAAGCCGATGAGGCCGATCGCAACGGCGTCTAT
TACGCTCTCGGCATCGTCGAGAACCTCTGCTCACGCTCGTCCACAGCCGCTCGCATCGGAGCCCACGACGCCCTT
CTCGGCTGGCTGCTACAGCGCATCCAACGCCAGGAGCAGCCTATAACCGTCTCCCAAAACAAGCAATACGCGGCC
GAGATCCTCGCCATCCTCTCCCAATCCTCCGCCGAGATCCGCCGCCAGATGGCCGCCCGCGACGCCATCGACATC
ATGCTGCAGCTTGTCGCCGTCTACCGGAAACGCGACCCGGACAAGGGCGGCGAGGAGGAAGAGTACATGGAGAAT
CTCTTCGAAGCCCTCACCTGCCTCGTCGATGAGCCGTCGGGAAAGGCCAAGTTCATTGAGGCCGAGGGCGTCGAG
CTCTGCCTCATCATGTTCAAGGAGGGCAAGCGCAGCAAAGCCCCGGCCCTTCGCCTCATGGACCACGCCGCAGGG
GGCGCTTCAGCCTCTGCCGTCGACGTGTGCGTCAAGCTCGTCGACGCCGGCGGCCTGCGTCCCCTCTTCACCCTC
TTCATCAAGAGCCGCGACCGGCGCTTGCAGGGCCATATGCTCGGTGTGCTGGCGTCGATGATGCGCCTGCTGCCG
GCCGGCTCGGCCGAGAGGATCCGCACGCTGGCCAAGTTCGTGGAGAAGGACTACGAGAAGACGGCCAAGCTTGTG
CAGCTTCATGTCGACTTTGCCGCTCTTGTCGGGCGTGCCGAGGCTCAGTATCGTCGGAACGCCGCGGGGGTGGAC
CCGGCCGATGCAGATGTCGAGCTACTGTCACGGAGGCTCGATGCCGGGCTCTTCGCCCTGCAGCAGGTGGACGTC
TTGCTGGCCTGGTTGGCGGCCGAGGACGGAGGAGCGAGGAAACGGGTCGAGCAGTTGCTGGCAGACCGGGATGAG
AGCTTGGCTACTGTGGCGGCCATCATCAAGGAGCAGCGTGAGGCTTTGGATACCACCGAGGAGGACAGCAAGGAT
ATGAGCGATATGTTAGATACACTGCTGGAGTTTGTGCGGTAG
Gene >Ophcf2|02498
ATGGCCAGCGTCGACGACATCTTCAAGGTTCGTCAATAGAGATCCTCTGAATCTTTCGAGTCTTCCGTCTCTTCT
TCTGGCTCACTCGATCTCGGCTCGCAGAACGTCGGCCTGCCTAGCAAGCGAAAACGAGAAGCCATCGCCGATCCA
AGTCCGTCCACATTCGCCTCGCCCACTATCTCCAAAGAACCTCTTTCGCTAACTCTGATGAATCATTTCACTCTA
TTCTCAGACGAATTCTATAAATCGAGCAAACTCAGCGCCTCAAGCCACCGAAAGCGCAACGAGGCCGAGGCTGAT
TCCACCGCTGCCGACGACGATGACGAGCTCGAGGCCGGCCCCGCGTCGCCGCCACATCAGGGAGAAGCAGACGAG
GAAGGCGACGATGATGAAGGTCGCTTCTTCGGCGGCGGTATCACTGCGAAAGAGTCCGAGGTCCTCGACTTCGTA
GCCGGCCTTGGCGAGGACGCAGACCGAGGCCCCGAAAAGATTGACGTCGCCTGGATGCGCAGGACTGCTCAGACG
CTGGAAAAGCGCATCGCGACAAACACGCGACTCCGCGCCAAGCACGAGGGTGAGCCGCAAAAGTTCATCGCCAGC
GAAGCCGAACTCGACGCCGACGTGAAAGCCTTGTCTATCCTTTCTGAACACCCGGAGCTGTATCCCGACTTTGTC
GCTCTCGGCTGCGCCGTTCATCTCGTCGGCCTACTCGCTCATGATAATACCGACATCGCCATCGACGCCCTGGAA
ATCATTGGCGAGCTGACGGACGAGGACGTCGCCGCCGACGACAGCCAGTGGGACGCTTTGGTCGACGCTCTGCTC
GACGCCGACCTGATCGGCCTGCTCGTCTCCAACCTGGCTCGCCTAGACGAAGCCGATGAGGCCGATCGCAACGGC
GTCTATTACGCTCTCGGCATCGTCGAGAACCTCTGCTCACGCTCGTCCACAGCCGCTCGCATCGGAGCCCACGAC
GCCCTTCTCGGCTGGCTGCTACAGCGCATCCAACGCCAGGAGCAGCCTATAACCGTCTCCCAAAACAAGCAATAC
GCGGCCGAGATCCTCGCCATCCTCTCCCAATCCTCCGCCGAGATCCGCCGCCAGATGGCCGCCCGCGACGCCATC
GACATCATGCTGCAGCTTGTCGCCGTCTACCGGAAACGCGACCCGGACAAGGGCGGCGAGGAGGAAGAGTACATG
GAGAATCTCTTCGAAGCCCTCACCTGCCTCGTCGATGAGCCGTCGGGAAAGGCCAAGTTCATTGAGGCCGAGGGC
GTCGAGCTCTGCCTCATCATGTTCAAGGAGGGCAAGCGCAGCAAAGCCCCGGCCCTTCGCCTCATGGACCACGCC
GCAGGGGGCGCTTCAGCCTCTGCCGTCGACGTGTGCGTCAAGCTCGTCGACGCCGGCGGCCTGCGTCCCCTCTTC
ACCCTCTTCATCAAGAGCCGCGACCGGCGCTTGCAGGGCCATATGCTCGGTGTGCTGGCGTCGATGATGCGCCTG
CTGCCGGCCGGCTCGGCCGAGAGGATCCGCACGCTGGCCAAGTTCGTGGAGAAGGACTACGAGAAGACGGCCAAG
CTTGTGCAGCTTCATGTCGACTTTGCCGCTCTTGTCGGGCGTGCCGAGGCTCAGTATCGTCGGAACGCCGCGGGG
GTGGACCCGGCCGATGCAGATGTCGAGCTACTGTCACGGAGGCTCGATGCCGGGCTCTTCGCCCTGCAGCAGGTG
GACGTCTTGCTGGCCTGGTTGGCGGCCGAGGACGGAGGAGCGAGGAAACGGGTCGAGCAGTTGCTGGCAGACCGG
GATGAGAGCTTGGCTACTGTGGCGGCCATCATCAAGGAGCAGCGTGAGGCTTTGGATACCACCGAGGAGGACAGC
AAGGATATGAGCGATATGTTAGATACACTGCTGGAGTTTGTGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail