Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02495
Gene name
Locationscaffold_02:3913502..3914551
Strand-
Gene length (bp)1049
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02586 SRAP SOS response associated peptidase (SRAP) 6.2E-79 1 239

GO

GO Term Description Terminal node
GO:0006974 cellular response to DNA damage stimulus Yes
GO:0018142 protein-DNA covalent cross-linking Yes
GO:0003697 single-stranded DNA binding Yes
GO:0019538 protein metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:0036211 protein modification process No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0018143 nucleic acid-protein covalent cross-linking No
GO:0050896 response to stimulus No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0003677 DNA binding No
GO:0043412 macromolecule modification No
GO:0006950 response to stress No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4383 0.5189 0.0295 0.1085 0.4877 0.0128 0.1071 0.1362 0.1338 0.0593

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4996
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4552
Ophiocordyceps australis map64 (Brazil) OphauB2|5425
Ophiocordyceps camponoti-floridani Ophcf2|02495 (this protein)
Ophiocordyceps kimflemingae Ophio5|2674
Ophiocordyceps subramaniannii Hirsu2|2344

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02495
MCGRYALALPASQVRQMLEDDAMAVDEAPDDGDNASRQSHNFAPGYHGIVYRAATSDRGAGSAPAGERRYRLQAM
KWGLIPFWTKRNPDYGTMLKTINCRDDSLSSPGGMWAAIKGRKRCLVIAQGFFEWLKKGPREKMPHFVRRRDGKL
MCFAGLWDCVQYHDLDEKAYSYTIITTSSNPQLRFLHDRMPVIFDPGSEDVKTWLDPGRSEWDDVLQGLLRPYDG
ELDVYPVSKEVGKVGNDSPSFIVPLDSKENKSNIANFFAKGGKGGSAETGKHKMGGEGEETPGSDEE*
Coding >Ophcf2|02495
ATGTGTGGGCGTTACGCGCTGGCTTTGCCGGCGTCGCAGGTTCGACAGATGCTCGAGGATGACGCCATGGCCGTC
GACGAAGCACCCGACGATGGAGACAACGCAAGCCGCCAGTCTCACAACTTTGCCCCGGGCTACCACGGCATCGTC
TACCGTGCCGCCACGTCGGATCGGGGCGCCGGCTCGGCTCCGGCCGGGGAGCGGCGATACCGACTGCAGGCCATG
AAGTGGGGGCTGATACCCTTCTGGACGAAGCGTAACCCTGACTACGGGACGATGCTCAAGACCATCAACTGCAGG
GACGACTCGCTGTCTTCTCCGGGTGGCATGTGGGCTGCTATCAAGGGACGGAAGCGCTGTCTTGTTATTGCTCAG
GGCTTCTTTGAGTGGTTGAAGAAGGGGCCGAGGGAGAAGATGCCGCATTTTGTTAGGAGGCGGGATGGGAAGCTC
ATGTGTTTCGCTGGGCTGTGGGATTGCGTTCAGTATCATGACTTGGACGAAAAGGCGTACTCGTACACCATCATC
ACCACCTCTTCCAACCCTCAGCTCCGCTTCCTGCACGACCGCATGCCCGTAATCTTCGACCCGGGCAGCGAAGAC
GTCAAGACCTGGCTCGATCCGGGCCGGAGCGAGTGGGATGACGTGCTGCAGGGACTGCTGCGGCCCTACGACGGC
GAGCTGGATGTGTATCCCGTCAGCAAGGAGGTTGGAAAGGTCGGCAACGACTCTCCCTCGTTTATTGTTCCGCTC
GATAGCAAGGAGAACAAGTCCAATATTGCGAATTTCTTTGCCAAGGGGGGGAAAGGGGGAAGCGCTGAGACGGGG
AAGCATAAGATGGGAGGCGAGGGTGAGGAAACGCCGGGATCCGATGAGGAGTAG
Transcript >Ophcf2|02495
ATGTGTGGGCGTTACGCGCTGGCTTTGCCGGCGTCGCAGGTTCGACAGATGCTCGAGGATGACGCCATGGCCGTC
GACGAAGCACCCGACGATGGAGACAACGCAAGCCGCCAGTCTCACAACTTTGCCCCGGGCTACCACGGCATCGTC
TACCGTGCCGCCACGTCGGATCGGGGCGCCGGCTCGGCTCCGGCCGGGGAGCGGCGATACCGACTGCAGGCCATG
AAGTGGGGGCTGATACCCTTCTGGACGAAGCGTAACCCTGACTACGGGACGATGCTCAAGACCATCAACTGCAGG
GACGACTCGCTGTCTTCTCCGGGTGGCATGTGGGCTGCTATCAAGGGACGGAAGCGCTGTCTTGTTATTGCTCAG
GGCTTCTTTGAGTGGTTGAAGAAGGGGCCGAGGGAGAAGATGCCGCATTTTGTTAGGAGGCGGGATGGGAAGCTC
ATGTGTTTCGCTGGGCTGTGGGATTGCGTTCAGTATCATGACTTGGACGAAAAGGCGTACTCGTACACCATCATC
ACCACCTCTTCCAACCCTCAGCTCCGCTTCCTGCACGACCGCATGCCCGTAATCTTCGACCCGGGCAGCGAAGAC
GTCAAGACCTGGCTCGATCCGGGCCGGAGCGAGTGGGATGACGTGCTGCAGGGACTGCTGCGGCCCTACGACGGC
GAGCTGGATGTGTATCCCGTCAGCAAGGAGGTTGGAAAGGTCGGCAACGACTCTCCCTCGTTTATTGTTCCGCTC
GATAGCAAGGAGAACAAGTCCAATATTGCGAATTTCTTTGCCAAGGGGGGGAAAGGGGGAAGCGCTGAGACGGGG
AAGCATAAGATGGGAGGCGAGGGTGAGGAAACGCCGGGATCCGATGAGGAGTAG
Gene >Ophcf2|02495
ATGTGTGGGCGTTACGCGCTGGCTTTGGTGAGCTCCACGAGCCGAGACACGCAACAGGTTGAACGCTGACGACCA
GCAGCCGGCGTCGCAGGTTCGACAGATGCTCGAGGATGACGCCATGGCCGTCGACGAAGCACCCGACGATGGAGA
CAACGCAAGCCGCCAGTCTCACAACTTTGCCCCGGGCTACCACGGCATCGTCTACCGTGCCGCCACGTCGGATCG
GGGCGCCGGCTCGGCTCCGGCCGGGGAGCGGCGATACCGACTGCAGGCCATGAAGTGGGGGCTGATACCCTTCTG
GACGAAGCGTAACCCTGACTACGGGACGATGCTCAAGACCATCAACTGCAGGGACGACTCGCTGTCTTCTCCGGG
TGGCATGTGGGCTGCTATCAAGGGACGGAAGCGCTGTCTTGTTATTGCTCAGGGCTTCTTTGAGTGGTTGAAGAA
GGGGCCGAGGGAGAAGATGCCGCATTTTGTTAGGAGGCGGGATGGGAAGCTCATGTGTTTCGCTGGGCTGTGGGA
TTGCGTTCAGTATCATGGTGAGGATCAGTCTGATTACAAGCAAGAGTCTCGCTCACATGATTTACATACCTAGAC
TTGGACGAAAAGGCGTACTCGTACACCATCATCACCACCTCTTCCAACCCTCAGCTCCGCTTCCTGCACGACCGC
ATGCCCGTAATCTTCGACCCGGGCAGCGAAGACGTCAAGACCTGGCTCGATCCGGGCCGGAGCGAGTGGGATGAC
GTGCTGCAGGGACTGCTGCGGCCCTACGACGGCGAGCTGGATGTGTATCCCGTCAGCAAGGAGGTTGGAAAGGTC
GGCAACGACTCTCCCTCGTTTATTGTTCCGCTCGATAGCAAGGAGAACAAGTCCAATATTGCGAATTTCTTTGCC
AAGGGGGGGAAAGGGGGAAGCGCTGAGACGGGGAAGCATAAGATGGGAGGCGAGGGTGAGGAAACGCCGGTGAGC
AAGGTGTCGCGGGGTGGGAAGATGGTGGCGGTGGGGGATTCGCCTGTGAAGAGAAGGGATCCGATGAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail