Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02493
Gene name
Locationscaffold_02:3893634..3895529
Strand-
Gene length (bp)1895
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 5.0E-28 39 154
PF00394 Cu-oxidase Multicopper oxidase 2.0E-22 164 315
PF07731 Cu-oxidase_2 Multicopper oxidase 1.9E-16 434 566

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005507 copper ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1371 0.1858 0.6678 0.2006 0.0795 0.0562 0.2438 0.3434 0.1543 0.0032

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999578

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup273
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|88
Ophiocordyceps australis map64 (Brazil) OphauB2|4831
Ophiocordyceps camponoti-floridani Ophcf2|02493 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02994
Ophiocordyceps camponoti-rufipedis Ophun1|4061
Ophiocordyceps camponoti-rufipedis Ophun1|5337
Ophiocordyceps kimflemingae Ophio5|7338
Ophiocordyceps kimflemingae Ophio5|8186
Ophiocordyceps kimflemingae Ophio5|8234
Ophiocordyceps subramaniannii Hirsu2|2347
Ophiocordyceps subramaniannii Hirsu2|8700

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02493
MGWKRWCLFLMPMAVSASSLSHSCRHRSCSFTPDVVLNVTRQTISIGGISRYSTLVNGSIPGPTIRIPEEQVVWI
RVYNEMSDDNLTMHWHGLAQAAYPFSDGTPMASQWPIPPHHFFDYELKTARGTAGSYYYHSHIGFQASTATGALI
VDDSGPPPYTYDEERLVFLQEYWPSTDDEVSRDLTATPRRWPGEPLGWLINGKTANGSGHMDVIDIDPGKTYRFR
FVAATALSLALLGFEHHGPFDVIQADAGYTEPRSVEWMQIGSGQRYDVLFRAKTCQELQKEDGRMDFYMQLESRE
RHEVVTSYAILRYSNDCFCGESKRLSEETIPTVKPLTLPPTIDGYLDYVLRPLSGVDDDDFPTAAEVTRRVVLHM
QQIRNSYVLWLVNDEAWTEAGTGPGPTRARPEEPYLVSLYRNRSAHLPDYGAAVSRGGLCPRTGTYPARIGEVVE
VVLQQLGAKALDGGDMQGPAAADTHPWHAHGPHVWDAGSGPGQWSPTEAERRLQGARPVKRDTTLLYRYGDAAAA
PDSAAGWRLWRLRVRQPGVWMVHCHTLQHMMQGMQTVWVHGDAVDLLSVGRPDVDGYLEYGGDAYGNSSYDPRVL
HFGDGECGPDCGR*
Coding >Ophcf2|02493
ATGGGTTGGAAACGCTGGTGCTTGTTCTTGATGCCCATGGCCGTATCGGCCTCATCTCTGAGCCATAGCTGTCGT
CACAGATCTTGTTCCTTTACGCCAGACGTGGTTCTCAACGTCACGAGACAGACCATCAGCATCGGTGGCATTTCC
CGTTACTCGACGCTCGTCAACGGATCGATTCCTGGACCGACCATCCGGATCCCGGAGGAACAGGTAGTCTGGATC
CGGGTATACAACGAGATGAGCGATGATAATCTCACCATGCATTGGCATGGACTCGCCCAGGCGGCGTACCCCTTT
TCGGACGGGACGCCCATGGCTAGCCAGTGGCCTATTCCTCCCCATCACTTCTTCGACTACGAGCTCAAGACGGCG
CGAGGTACGGCTGGTTCATACTACTATCACTCTCACATCGGCTTCCAGGCCAGCACGGCTACCGGGGCGCTGATA
GTCGACGACTCGGGGCCGCCGCCGTACACGTACGACGAGGAGCGCCTCGTGTTTCTGCAAGAATACTGGCCCTCG
ACGGACGATGAGGTATCTAGGGATCTGACTGCCACGCCGCGGCGCTGGCCGGGGGAACCACTGGGTTGGTTGATC
AACGGGAAGACGGCCAACGGCAGCGGTCATATGGACGTTATTGACATCGATCCGGGCAAGACGTATCGCTTTCGG
TTCGTCGCGGCAACGGCGCTTTCTCTGGCGCTTCTCGGCTTCGAGCATCATGGACCGTTTGACGTGATTCAGGCT
GATGCTGGATATACCGAGCCTCGTTCCGTCGAATGGATGCAAATAGGGTCGGGTCAGCGATACGACGTTCTCTTT
CGAGCCAAAACCTGCCAAGAGCTTCAGAAAGAGGACGGCAGGATGGACTTTTACATGCAGCTGGAGAGCAGGGAG
CGACACGAGGTCGTCACCAGCTACGCCATCCTGCGATACAGCAACGATTGCTTCTGCGGCGAGTCAAAGAGGTTG
TCGGAGGAAACTATTCCCACGGTGAAGCCTCTGACGCTGCCGCCTACAATCGACGGATATCTCGACTACGTGCTT
CGGCCCCTGAGCGGCGTCGACGACGATGATTTCCCCACTGCGGCCGAGGTGACCCGTCGCGTAGTCCTACACATG
CAGCAGATCAGAAACAGTTACGTGCTCTGGCTCGTCAACGATGAGGCCTGGACCGAGGCCGGTACCGGACCCGGA
CCGACGCGGGCTCGGCCAGAGGAACCGTACCTTGTGTCGTTATACCGAAACCGTTCCGCACACCTACCAGACTAC
GGAGCAGCTGTATCACGAGGTGGCCTGTGTCCTCGAACGGGGACTTACCCGGCCCGAATCGGCGAGGTCGTCGAG
GTAGTGCTGCAGCAGTTAGGAGCCAAGGCCCTAGACGGAGGCGATATGCAAGGTCCGGCAGCAGCAGACACGCAC
CCGTGGCACGCCCACGGACCGCACGTCTGGGACGCCGGCAGCGGACCCGGACAATGGAGCCCGACCGAAGCCGAG
CGCCGACTACAAGGGGCACGGCCCGTAAAGCGCGACACGACGCTCCTGTATCGCTACGGCGACGCGGCGGCAGCG
CCGGACTCGGCGGCGGGCTGGCGGCTTTGGCGGCTCCGCGTCCGGCAGCCGGGCGTGTGGATGGTGCACTGCCAC
ACGCTGCAGCACATGATGCAGGGAATGCAGACCGTCTGGGTTCACGGAGACGCCGTCGATTTGCTGAGCGTCGGC
AGGCCGGATGTCGACGGCTACCTCGAATACGGGGGTGATGCGTACGGGAACAGCAGCTACGATCCGCGCGTGCTT
CACTTTGGTGACGGGGAGTGCGGTCCGGATTGTGGCCGGTAG
Transcript >Ophcf2|02493
ATGGGTTGGAAACGCTGGTGCTTGTTCTTGATGCCCATGGCCGTATCGGCCTCATCTCTGAGCCATAGCTGTCGT
CACAGATCTTGTTCCTTTACGCCAGACGTGGTTCTCAACGTCACGAGACAGACCATCAGCATCGGTGGCATTTCC
CGTTACTCGACGCTCGTCAACGGATCGATTCCTGGACCGACCATCCGGATCCCGGAGGAACAGGTAGTCTGGATC
CGGGTATACAACGAGATGAGCGATGATAATCTCACCATGCATTGGCATGGACTCGCCCAGGCGGCGTACCCCTTT
TCGGACGGGACGCCCATGGCTAGCCAGTGGCCTATTCCTCCCCATCACTTCTTCGACTACGAGCTCAAGACGGCG
CGAGGTACGGCTGGTTCATACTACTATCACTCTCACATCGGCTTCCAGGCCAGCACGGCTACCGGGGCGCTGATA
GTCGACGACTCGGGGCCGCCGCCGTACACGTACGACGAGGAGCGCCTCGTGTTTCTGCAAGAATACTGGCCCTCG
ACGGACGATGAGGTATCTAGGGATCTGACTGCCACGCCGCGGCGCTGGCCGGGGGAACCACTGGGTTGGTTGATC
AACGGGAAGACGGCCAACGGCAGCGGTCATATGGACGTTATTGACATCGATCCGGGCAAGACGTATCGCTTTCGG
TTCGTCGCGGCAACGGCGCTTTCTCTGGCGCTTCTCGGCTTCGAGCATCATGGACCGTTTGACGTGATTCAGGCT
GATGCTGGATATACCGAGCCTCGTTCCGTCGAATGGATGCAAATAGGGTCGGGTCAGCGATACGACGTTCTCTTT
CGAGCCAAAACCTGCCAAGAGCTTCAGAAAGAGGACGGCAGGATGGACTTTTACATGCAGCTGGAGAGCAGGGAG
CGACACGAGGTCGTCACCAGCTACGCCATCCTGCGATACAGCAACGATTGCTTCTGCGGCGAGTCAAAGAGGTTG
TCGGAGGAAACTATTCCCACGGTGAAGCCTCTGACGCTGCCGCCTACAATCGACGGATATCTCGACTACGTGCTT
CGGCCCCTGAGCGGCGTCGACGACGATGATTTCCCCACTGCGGCCGAGGTGACCCGTCGCGTAGTCCTACACATG
CAGCAGATCAGAAACAGTTACGTGCTCTGGCTCGTCAACGATGAGGCCTGGACCGAGGCCGGTACCGGACCCGGA
CCGACGCGGGCTCGGCCAGAGGAACCGTACCTTGTGTCGTTATACCGAAACCGTTCCGCACACCTACCAGACTAC
GGAGCAGCTGTATCACGAGGTGGCCTGTGTCCTCGAACGGGGACTTACCCGGCCCGAATCGGCGAGGTCGTCGAG
GTAGTGCTGCAGCAGTTAGGAGCCAAGGCCCTAGACGGAGGCGATATGCAAGGTCCGGCAGCAGCAGACACGCAC
CCGTGGCACGCCCACGGACCGCACGTCTGGGACGCCGGCAGCGGACCCGGACAATGGAGCCCGACCGAAGCCGAG
CGCCGACTACAAGGGGCACGGCCCGTAAAGCGCGACACGACGCTCCTGTATCGCTACGGCGACGCGGCGGCAGCG
CCGGACTCGGCGGCGGGCTGGCGGCTTTGGCGGCTCCGCGTCCGGCAGCCGGGCGTGTGGATGGTGCACTGCCAC
ACGCTGCAGCACATGATGCAGGGAATGCAGACCGTCTGGGTTCACGGAGACGCCGTCGATTTGCTGAGCGTCGGC
AGGCCGGATGTCGACGGCTACCTCGAATACGGGGGTGATGCGTACGGGAACAGCAGCTACGATCCGCGCGTGCTT
CACTTTGGTGACGGGGAGTGCGGTCCGGATTGTGGCCGGTAG
Gene >Ophcf2|02493
ATGGGTTGGAAACGCTGGTGCTTGTTCTTGATGCCCATGGCCGTATCGGCCTCATCTCTGAGCCATAGCTGTCGT
CACAGATCTTGTTCCTTTACGCCAGACGTGGTTCTCAACGTCACGAGACAGACCATCAGCATCGGTGGCATTTCC
CGTTACTCGACGCTCGTCAACGGATCGATTCCTGGACCGACCATCCGGATCCCGGAGGAACAGGTAGTCTGGATC
CGGGTATACAACGAGATGAGCGATGATAATCTCACCATGGTTTGTCGACGCGTGCTCCCCAGCTTGACATGTATC
TGCTGAAACACGGACAGCATTGGCATGGACTCGCCCAGGCGGCGTACCCCTTTTCGGACGGGACGCCCATGGCTA
GCCAGTGGCCTATTCCTCCCCATCACTTCTTCGACTACGAGCTCAAGACGGCGCGAGGTACGGCTGGTTCATACT
ACTATCACTCTCACATCGGCTTCCAGGCCAGCACGGCTACCGGGGCGCTGATAGTCGACGACTCGGGGCCGCCGC
CGTACACGTACGACGAGGAGCGCCTCGTGTTTCTGCAAGAATACTGGCCCTCGACGGACGATGAGGTATCTAGGG
ATCTGACTGCCACGCCGCGGCGCTGGCCGGGGGAACCACTGGGTTGGTTGATCAACGGGAAGACGGCCAACGGCA
GCGGTCATATGGACGTTATTGACATCGATCCGGGCAAGACGTATCGCTTTCGGTTCGTCGCGGCAACGGCGCTTT
CTCTGGCGCTTCTCGGCTTCGAGCATCATGGACCGTTTGACGTGATTCAGGCTGATGCTGGATATACCGAGCCTC
GTTCCGTCGAATGGATGCAAATAGGGTCGGGTCAGCGATACGACGTTCTCTTTCGAGCCAAAACCTGCCAAGAGC
TTCAGAAAGAGGACGGCAGGATGGACTTTTACATGCAGCTGGAGAGCAGGGAGCGACACGAGGTCGTCACCAGCT
ACGCCATCCTGCGATACAGCAACGATTGCTTCTGCGGCGAGTCAAAGAGGTTGTCGGAGGAAACTATTCCCACGG
TGAAGCCTCTGACGCTGCCGCCTACAATCGACGGATATCTCGACTACGTGCTTCGGCCCCTGAGCGGCGTCGACG
ACGATGATTTCCCCACTGCGGCCGAGGTGACCCGTCGCGTAGTCCTACACATGCAGCAGATCAGAAACAGTTACG
TGCTCTGGCTCGTCAACGATGAGGCCTGGACCGAGGCCGGTACCGGACCCGGACCGACGCGGGCTCGGCCAGAGG
AACCGTACCTTGTGTCGTTATACCGAAACCGTTCCGCACACCTACCAGACTACGGAGCAGCTGTATCACGAGGTG
GCCTGTGTCCTCGAACGGGGACTTACCCGGCCCGAATCGGCGAGGTCGTCGAGGTAGTGCTGCAGCAGTTAGGAG
CCAAGGCCCTAGACGGAGGCGATATGCAAGGTCCGGCAGCAGCAGACACGCACCCGTGGCACGCCCACGGACCGC
ACGTCTGGGACGCCGGCAGCGGACCCGGACAATGGAGCCCGACCGAAGCCGAGCGCCGACTACAAGGGGCACGGC
CCGTAAAGCGCGACACGACGCTCCTGTATCGCTACGGCGACGCGGCGGCAGCGCCGGACTCGGCGGCGGGCTGGC
GGCTTTGGCGGCTCCGCGTCCGGCAGCCGGGCGTGTGGATGGTGCACTGCCACACGCTGCAGCACATGATGCAGG
GAATGCAGACCGTCTGGGTTCACGGAGACGCCGTCGATTTGCTGAGCGTCGGCAGGCCGGATGTCGACGGCTACC
TCGAATACGGGGGTGATGCGTACGGGAACAGCAGCTACGATCCGCGCGTGCTTCACTTTGGTGACGGGGAGTGCG
GTCCGGATTGTGGCCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail