Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02491
Gene name
Locationscaffold_02:3883628..3888195
Strand+
Gene length (bp)4567
Transcript length (bp)3735
Coding sequence length (bp)3735
Protein length (aa) 1245

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02862 DDHD DDHD domain 3.4E-73 922 1211

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole 0.5386 0.3315 0.1789 0.1074 0.4353 0.2262 0.4677 0.5777 0.6058 0.0863

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup800
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2809
Ophiocordyceps australis 1348a (Ghana) OphauG2|4878
Ophiocordyceps australis map64 (Brazil) OphauB2|6337
Ophiocordyceps camponoti-floridani Ophcf2|02491 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4059
Ophiocordyceps kimflemingae Ophio5|473
Ophiocordyceps subramaniannii Hirsu2|349

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02491
MSQCRSCREPLTFNVSSEDEADIVTVPDDLNLPCGCHFHWECMMDVAHRVASTLECPVCCKNVGVRADGPSTTDE
TRSGAIIAQYTSEDGVQADVNLLPFLAEEASVRQHPLGRLSQALHHMCAEGDVAAMVELLRENSVSEELLGWTDK
MNNESSLLHVAVDRQHEEAVWLLLWLMSELPIESFPSAVRDIVEAMNLPRLHIGKILDIRNKRDCFGRTAEDLAR
QKPEAWAAMLEAKLLLDSAIYDKRDCKLSIPDHGFDLMLPVIDATAVLLLQHRPGLAWHSAAMADRKTERSYLNS
AVDSINPWASSRPTTPASDARRDELPVAATAAPGDHVLTPFYGQSLRSYPKDCPPLNVLWFHAVDIPKRKPQIIK
GRQKASKDAKPNARPKKFTAFSASDSRRLEARYQKLLEATEDGRGGGSKAATQSRIDSPDRKGRARQANSAEPGG
KRVPVNEDYLFDVDIEERELEPVYWLGPIYEVRRGTWFFQEGSNLRPCEENLAAQLEEGYLKMKPWLFSASPRSQ
AAGTETPKSDSSVVFKKQTSAGTSTPKTTQEPESGPSTPPQLATTHTPQPYRLFGAYMSSVATYPDANTAWLCSD
GVLSWVTTSVYERFAGGGYMSGAKLVRGYTEANKAKEKEKDDRNQDVSAKTDDGPEKDSSMGASDDDVVNRQATL
QRQLSSLIENEAESEEQIRKREEQEIRDDYNAQDGESQGREIDHLVLVTHGIGQRLGLRMESVNFVHDVNVLRQT
LKSVYANSADLKALNSKGDPGDCRVQVLPVCWRHLFEFPKQRQRKAEYDLGDLAGEEDRYPSLDDITVEGVAFAR
SLISDLALDVLLYQSSYRDEISKAVVGEANRIVGLFRQRNADFKGKVHLMGHSLGSAIFFDVLCRQKDEAAGGQG
HNPLSFWPRQGRQKPKQGDLQFDFDVHDYFCLGSPVGLFQMLKGRTIAARRPARNDAYHAAEADASCSGRGISSS
VSSPKVGQLFNIFHPSDPISYRLEPLISTAMATLKPQALPYTKRGIFDSVAPQGLTGLGAKVGQSVSGLWSSLSA
GIASNLLNRSLGLTADEVTRIAAEESARHGSHDGRGDSRQVASRTGAAPSSAAETDRRKQKLADAPATGDHGDVL
IDGELETLYARFQNGRAVASGSDGDSSRARRMRTEEMRVRALNRNGRVDYSIQESALDFNPINTIASHMGYWADE
DVNHFILSQLLSSRPRSTTTTTTTTTTTTVDDAMDITSAPHGDL*
Coding >Ophcf2|02491
ATGTCTCAATGTCGGTCTTGTCGAGAGCCGCTTACCTTCAACGTCTCGTCCGAGGATGAAGCCGACATCGTGACG
GTGCCTGACGACCTAAACCTTCCATGTGGCTGCCACTTCCATTGGGAGTGCATGATGGACGTGGCCCATCGTGTG
GCCTCGACGCTCGAGTGTCCCGTCTGCTGCAAGAATGTGGGTGTGAGGGCAGACGGTCCGTCAACGACCGACGAG
ACCAGGTCGGGCGCCATCATAGCACAATACACCAGCGAGGATGGTGTGCAAGCGGATGTCAACCTACTGCCTTTT
CTCGCCGAAGAGGCGTCTGTCCGGCAACACCCGTTGGGGCGGCTTTCGCAGGCGCTGCATCATATGTGCGCCGAG
GGCGACGTAGCCGCCATGGTCGAGCTCTTGCGCGAGAACTCCGTTTCGGAAGAGCTCCTAGGATGGACTGACAAG
ATGAACAATGAGTCTAGCCTTCTTCACGTCGCCGTTGATAGGCAGCACGAAGAAGCTGTCTGGTTACTGCTTTGG
CTGATGTCGGAGCTGCCGATCGAATCGTTTCCCTCGGCCGTGCGCGACATCGTCGAAGCTATGAACCTCCCGCGG
CTCCACATCGGCAAGATTTTGGACATTCGAAACAAGAGAGACTGCTTTGGCCGCACGGCCGAGGACCTTGCGCGA
CAGAAACCCGAGGCGTGGGCCGCCATGCTCGAGGCTAAACTACTGCTTGACAGTGCAATCTATGACAAACGAGAC
TGTAAGCTATCGATACCGGATCACGGCTTCGACCTCATGCTTCCCGTCATTGACGCGACTGCCGTTCTCTTGCTT
CAGCACCGGCCCGGTCTTGCGTGGCATTCGGCCGCCATGGCTGATCGCAAGACCGAGAGGTCCTACCTGAACTCG
GCCGTCGACTCCATCAATCCCTGGGCCTCGAGCCGTCCGACGACGCCGGCCTCCGACGCCCGACGCGATGAGCTG
CCCGTCGCTGCAACGGCAGCTCCCGGAGATCATGTCCTGACTCCATTCTACGGCCAGAGCCTCCGCAGTTATCCC
AAGGACTGCCCGCCACTGAATGTCCTTTGGTTTCACGCGGTTGACATCCCGAAGCGAAAGCCACAGATTATCAAG
GGCCGCCAGAAAGCCTCAAAGGATGCCAAGCCAAATGCCCGTCCCAAGAAGTTCACGGCCTTCTCGGCCTCCGAC
TCGCGGAGGCTAGAGGCTCGCTATCAGAAGCTACTAGAAGCCACCGAGGATGGCCGCGGTGGCGGCTCCAAGGCG
GCCACACAGTCCAGGATCGACAGTCCAGACCGCAAAGGTAGGGCACGTCAAGCCAACTCTGCAGAGCCTGGAGGC
AAGCGAGTGCCGGTGAACGAGGACTATCTGTTCGACGTTGATATCGAAGAGCGAGAACTCGAGCCCGTATACTGG
CTAGGTCCCATCTACGAAGTTCGCCGAGGCACATGGTTCTTTCAAGAGGGCTCAAATCTACGACCATGCGAGGAG
AATCTGGCGGCTCAGCTGGAAGAGGGTTACCTCAAGATGAAGCCGTGGCTGTTTTCAGCATCCCCTCGGAGTCAG
GCGGCCGGGACAGAGACGCCAAAAAGCGACTCAAGCGTCGTCTTCAAGAAGCAGACGTCCGCTGGCACGTCGACA
CCCAAGACGACGCAGGAGCCAGAGTCTGGTCCGTCTACACCGCCTCAGTTGGCCACGACGCACACGCCGCAACCG
TATCGGCTGTTCGGCGCATACATGAGCAGCGTTGCCACTTACCCAGACGCAAATACAGCCTGGCTGTGCAGCGAC
GGCGTTCTTTCCTGGGTCACGACGTCTGTCTACGAAAGGTTCGCCGGAGGTGGCTACATGAGCGGCGCCAAGCTC
GTCAGGGGATATACCGAAGCCAACAAGGCCAAGGAGAAGGAGAAGGACGACAGAAACCAGGATGTGTCGGCCAAG
ACCGACGACGGACCGGAAAAGGATTCGTCTATGGGCGCAAGCGATGATGATGTTGTGAACCGGCAAGCCACACTG
CAGCGACAGCTCTCGTCTCTGATTGAGAACGAGGCCGAGAGCGAGGAGCAAATACGGAAACGCGAGGAGCAGGAG
ATCCGGGATGACTACAACGCACAGGACGGCGAATCTCAGGGCCGCGAGATCGATCACCTGGTGCTGGTGACGCAC
GGCATCGGCCAACGACTCGGCCTCCGGATGGAGAGCGTCAACTTTGTCCACGACGTCAACGTGCTGCGCCAGACT
CTCAAGTCTGTTTACGCCAACTCGGCCGACCTGAAGGCGCTGAATTCCAAGGGCGACCCGGGAGACTGTCGGGTG
CAGGTGTTGCCGGTCTGCTGGAGGCATCTGTTCGAGTTTCCGAAGCAGCGCCAGCGCAAGGCCGAGTATGACCTG
GGCGATCTCGCGGGCGAGGAGGACAGATATCCGTCACTGGACGACATCACGGTCGAGGGCGTCGCCTTTGCGCGG
TCTCTCATCTCGGATCTAGCCCTGGACGTGCTTCTATACCAGAGCTCGTATCGCGACGAGATCTCCAAGGCCGTC
GTCGGCGAGGCGAATCGCATCGTCGGTCTGTTCCGGCAGAGAAATGCCGACTTCAAGGGAAAGGTGCATTTGATG
GGTCATTCGCTGGGCTCGGCCATCTTCTTTGACGTCTTGTGTCGGCAAAAGGACGAAGCAGCCGGTGGTCAGGGG
CATAATCCGCTAAGCTTCTGGCCTCGTCAGGGCCGTCAGAAGCCCAAGCAGGGCGACCTCCAGTTCGATTTTGAC
GTTCACGACTACTTTTGTCTGGGCTCGCCCGTCGGCCTGTTCCAGATGCTTAAGGGGCGGACCATTGCTGCTCGA
CGACCGGCTCGCAACGACGCCTATCACGCGGCAGAAGCCGACGCGTCATGTTCCGGTCGTGGAATATCGTCGTCG
GTATCTTCGCCCAAGGTCGGACAACTCTTCAACATCTTTCACCCGTCAGACCCCATCAGCTACCGCCTCGAGCCC
CTCATCTCTACCGCCATGGCGACTCTCAAGCCGCAAGCGCTGCCCTACACCAAACGCGGCATCTTCGACAGCGTC
GCGCCACAAGGCCTGACGGGCTTGGGCGCAAAAGTAGGCCAGAGCGTCAGCGGCCTTTGGTCCAGCCTCAGCGCC
GGCATCGCAAGCAATCTGCTGAACCGGAGTCTGGGCCTCACCGCCGACGAGGTGACTCGCATCGCAGCGGAGGAA
TCTGCCCGCCATGGCAGTCATGACGGCCGAGGTGACAGCCGTCAAGTCGCATCTCGGACCGGCGCCGCTCCCTCA
TCGGCCGCCGAGACGGACAGACGGAAGCAGAAGCTCGCAGATGCGCCGGCTACGGGCGATCACGGAGACGTCCTC
ATCGACGGCGAACTGGAGACGCTCTACGCTCGGTTTCAGAACGGTAGAGCCGTCGCCTCTGGCTCGGATGGCGAT
TCTTCGAGGGCTCGCAGGATGCGGACTGAGGAGATGCGCGTGAGGGCTCTGAATCGCAACGGACGCGTCGACTAT
AGCATTCAAGAGAGCGCCCTCGATTTCAACCCCATCAACACCATTGCCTCGCACATGGGCTACTGGGCCGACGAG
GACGTCAACCACTTTATCCTCTCGCAGCTGCTATCCAGCCGTCCGCGGTCGACGACGACGACGACGACGACGACG
ACGACGACGACGGTAGACGACGCCATGGATATAACGAGCGCGCCACACGGCGACTTGTAA
Transcript >Ophcf2|02491
ATGTCTCAATGTCGGTCTTGTCGAGAGCCGCTTACCTTCAACGTCTCGTCCGAGGATGAAGCCGACATCGTGACG
GTGCCTGACGACCTAAACCTTCCATGTGGCTGCCACTTCCATTGGGAGTGCATGATGGACGTGGCCCATCGTGTG
GCCTCGACGCTCGAGTGTCCCGTCTGCTGCAAGAATGTGGGTGTGAGGGCAGACGGTCCGTCAACGACCGACGAG
ACCAGGTCGGGCGCCATCATAGCACAATACACCAGCGAGGATGGTGTGCAAGCGGATGTCAACCTACTGCCTTTT
CTCGCCGAAGAGGCGTCTGTCCGGCAACACCCGTTGGGGCGGCTTTCGCAGGCGCTGCATCATATGTGCGCCGAG
GGCGACGTAGCCGCCATGGTCGAGCTCTTGCGCGAGAACTCCGTTTCGGAAGAGCTCCTAGGATGGACTGACAAG
ATGAACAATGAGTCTAGCCTTCTTCACGTCGCCGTTGATAGGCAGCACGAAGAAGCTGTCTGGTTACTGCTTTGG
CTGATGTCGGAGCTGCCGATCGAATCGTTTCCCTCGGCCGTGCGCGACATCGTCGAAGCTATGAACCTCCCGCGG
CTCCACATCGGCAAGATTTTGGACATTCGAAACAAGAGAGACTGCTTTGGCCGCACGGCCGAGGACCTTGCGCGA
CAGAAACCCGAGGCGTGGGCCGCCATGCTCGAGGCTAAACTACTGCTTGACAGTGCAATCTATGACAAACGAGAC
TGTAAGCTATCGATACCGGATCACGGCTTCGACCTCATGCTTCCCGTCATTGACGCGACTGCCGTTCTCTTGCTT
CAGCACCGGCCCGGTCTTGCGTGGCATTCGGCCGCCATGGCTGATCGCAAGACCGAGAGGTCCTACCTGAACTCG
GCCGTCGACTCCATCAATCCCTGGGCCTCGAGCCGTCCGACGACGCCGGCCTCCGACGCCCGACGCGATGAGCTG
CCCGTCGCTGCAACGGCAGCTCCCGGAGATCATGTCCTGACTCCATTCTACGGCCAGAGCCTCCGCAGTTATCCC
AAGGACTGCCCGCCACTGAATGTCCTTTGGTTTCACGCGGTTGACATCCCGAAGCGAAAGCCACAGATTATCAAG
GGCCGCCAGAAAGCCTCAAAGGATGCCAAGCCAAATGCCCGTCCCAAGAAGTTCACGGCCTTCTCGGCCTCCGAC
TCGCGGAGGCTAGAGGCTCGCTATCAGAAGCTACTAGAAGCCACCGAGGATGGCCGCGGTGGCGGCTCCAAGGCG
GCCACACAGTCCAGGATCGACAGTCCAGACCGCAAAGGTAGGGCACGTCAAGCCAACTCTGCAGAGCCTGGAGGC
AAGCGAGTGCCGGTGAACGAGGACTATCTGTTCGACGTTGATATCGAAGAGCGAGAACTCGAGCCCGTATACTGG
CTAGGTCCCATCTACGAAGTTCGCCGAGGCACATGGTTCTTTCAAGAGGGCTCAAATCTACGACCATGCGAGGAG
AATCTGGCGGCTCAGCTGGAAGAGGGTTACCTCAAGATGAAGCCGTGGCTGTTTTCAGCATCCCCTCGGAGTCAG
GCGGCCGGGACAGAGACGCCAAAAAGCGACTCAAGCGTCGTCTTCAAGAAGCAGACGTCCGCTGGCACGTCGACA
CCCAAGACGACGCAGGAGCCAGAGTCTGGTCCGTCTACACCGCCTCAGTTGGCCACGACGCACACGCCGCAACCG
TATCGGCTGTTCGGCGCATACATGAGCAGCGTTGCCACTTACCCAGACGCAAATACAGCCTGGCTGTGCAGCGAC
GGCGTTCTTTCCTGGGTCACGACGTCTGTCTACGAAAGGTTCGCCGGAGGTGGCTACATGAGCGGCGCCAAGCTC
GTCAGGGGATATACCGAAGCCAACAAGGCCAAGGAGAAGGAGAAGGACGACAGAAACCAGGATGTGTCGGCCAAG
ACCGACGACGGACCGGAAAAGGATTCGTCTATGGGCGCAAGCGATGATGATGTTGTGAACCGGCAAGCCACACTG
CAGCGACAGCTCTCGTCTCTGATTGAGAACGAGGCCGAGAGCGAGGAGCAAATACGGAAACGCGAGGAGCAGGAG
ATCCGGGATGACTACAACGCACAGGACGGCGAATCTCAGGGCCGCGAGATCGATCACCTGGTGCTGGTGACGCAC
GGCATCGGCCAACGACTCGGCCTCCGGATGGAGAGCGTCAACTTTGTCCACGACGTCAACGTGCTGCGCCAGACT
CTCAAGTCTGTTTACGCCAACTCGGCCGACCTGAAGGCGCTGAATTCCAAGGGCGACCCGGGAGACTGTCGGGTG
CAGGTGTTGCCGGTCTGCTGGAGGCATCTGTTCGAGTTTCCGAAGCAGCGCCAGCGCAAGGCCGAGTATGACCTG
GGCGATCTCGCGGGCGAGGAGGACAGATATCCGTCACTGGACGACATCACGGTCGAGGGCGTCGCCTTTGCGCGG
TCTCTCATCTCGGATCTAGCCCTGGACGTGCTTCTATACCAGAGCTCGTATCGCGACGAGATCTCCAAGGCCGTC
GTCGGCGAGGCGAATCGCATCGTCGGTCTGTTCCGGCAGAGAAATGCCGACTTCAAGGGAAAGGTGCATTTGATG
GGTCATTCGCTGGGCTCGGCCATCTTCTTTGACGTCTTGTGTCGGCAAAAGGACGAAGCAGCCGGTGGTCAGGGG
CATAATCCGCTAAGCTTCTGGCCTCGTCAGGGCCGTCAGAAGCCCAAGCAGGGCGACCTCCAGTTCGATTTTGAC
GTTCACGACTACTTTTGTCTGGGCTCGCCCGTCGGCCTGTTCCAGATGCTTAAGGGGCGGACCATTGCTGCTCGA
CGACCGGCTCGCAACGACGCCTATCACGCGGCAGAAGCCGACGCGTCATGTTCCGGTCGTGGAATATCGTCGTCG
GTATCTTCGCCCAAGGTCGGACAACTCTTCAACATCTTTCACCCGTCAGACCCCATCAGCTACCGCCTCGAGCCC
CTCATCTCTACCGCCATGGCGACTCTCAAGCCGCAAGCGCTGCCCTACACCAAACGCGGCATCTTCGACAGCGTC
GCGCCACAAGGCCTGACGGGCTTGGGCGCAAAAGTAGGCCAGAGCGTCAGCGGCCTTTGGTCCAGCCTCAGCGCC
GGCATCGCAAGCAATCTGCTGAACCGGAGTCTGGGCCTCACCGCCGACGAGGTGACTCGCATCGCAGCGGAGGAA
TCTGCCCGCCATGGCAGTCATGACGGCCGAGGTGACAGCCGTCAAGTCGCATCTCGGACCGGCGCCGCTCCCTCA
TCGGCCGCCGAGACGGACAGACGGAAGCAGAAGCTCGCAGATGCGCCGGCTACGGGCGATCACGGAGACGTCCTC
ATCGACGGCGAACTGGAGACGCTCTACGCTCGGTTTCAGAACGGTAGAGCCGTCGCCTCTGGCTCGGATGGCGAT
TCTTCGAGGGCTCGCAGGATGCGGACTGAGGAGATGCGCGTGAGGGCTCTGAATCGCAACGGACGCGTCGACTAT
AGCATTCAAGAGAGCGCCCTCGATTTCAACCCCATCAACACCATTGCCTCGCACATGGGCTACTGGGCCGACGAG
GACGTCAACCACTTTATCCTCTCGCAGCTGCTATCCAGCCGTCCGCGGTCGACGACGACGACGACGACGACGACG
ACGACGACGACGGTAGACGACGCCATGGATATAACGAGCGCGCCACACGGCGACTTGTAA
Gene >Ophcf2|02491
ATGTCTCAATGTCGGTCTTGTCGAGAGCCGCTTACCTTCAACGTCTCGTCCGAGGATGAAGCCGACATCGTGACG
GTGCCTGACGACCTAAACCTTCCATGTGGCTGCCACTTCCATTGGTACTGGATTGACATCGGACGAGGCGATTCG
AGGCCTCGCCGCTGGTAGTTCTAGCTAATAATTGGCACAATTAGGGAGTGCATGATGGACGTGGCCCATCGTGTG
GCCTCGACGCTCGAGTGTCCCGTCTGCTGCAAGAATGTGGGTGTGAGGGCAGACGGTCCGTCAACGACCGACGAG
ACCAGGTCGGGCGCCATCATAGCACAATACACCAGCGAGGATGGTGTGCAAGCGGATGTCAACCTACTGCCTTTT
CTCGCCGAAGAGGCGTCTGTCCGGCAACACCCGTTGGGGCGGCTTTCGCAGGCGCTGCATCATATGTGCGCCGAG
GGCGACGTAGCCGCCATGGTCGAGCTCTTGCGCGAGAACTCCGTTTCGGAAGAGCTCCTAGGATGGACTGACAAG
ATGAACAATGAGTCTAGCCTTCTTCACGTCGCCGTTGATAGGCAGCACGAAGAAGCTGTCTGGTTACTGCTTTGG
CTGATGTCGGAGCTGCCGATCGAATCGTTTCCCTCGGCCGTGCGCGACATCGTCGAAGCTATGAACCTCCCGCGG
CTCCACATCGGCAAGATTTTGGACATTCGAAACAAGAGAGACTGCTTTGGCCGCACGGCCGAGGACCTTGCGCGA
CAGAAACCCGAGGCGTGGGCCGCCATGCTCGAGGCTAAACTACTGCTTGGTCCTGAAGCGTGAAAAACGTTTGTG
GCGCATGATGGGGGTAGACTGCGCCACACGGTTACTGTATGGTGCCAATCGGCCGAAAAGGGGCACTGTACTAGA
ATAACAAAAAACACAGTGTTTAAACTGTATTTCAAAGTGAACAGACAGTGCAATCTATGACAAACGAGACTGTAA
GCTATCGATACCGGATCACGGCTTCGACCTCATGCTTCCCGTCATTGACGCGACTGCCGTTCTCTTGGTGTGTTA
TGCCGCTTATGCGTCTGCGCCTCCGTCCTAAACAGCTATTGAATTGCTGCTCCTTTGCCCAGCTTCAGCACCGGC
CCGGTCTTGCGTGGCATTCGGCCGCCATGGCTGATCGCAAGACCGAGAGGTCCTACCTGAACTCGGCCGTCGACT
CCATCAATCCCTGGGCCTCGAGCCGTCCGACGACGCCGGCCTCCGACGCCCGACGCGATGAGCTGCCCGTCGCTG
CAACGGCAGCTCCCGGAGATCATGTCCTGACTCCATTCTACGGCCAGAGCCTCCGCAGTTATCCCAAGGACTGCC
CGCCACTGAATGTCCTTTGGTTTCACGCGGTTGACGTAGGGAGACACACCGCAAGCCCTATCTTAGTGCCTACCT
CTGATTTGACACTGATTTGGCATCGGTATTATGAGTAGATCCCGAAGCGAAAGCCACAGATTATCAAGGGCCGCC
AGAAAGCCTCAAAGGATGCCAAGCCAAATGCCCGTCCCAAGAAGTTCACGGCCTTCTCGGCCTCCGACTCGCGGA
GGCTAGAGGCTCGCTATCAGAAGCTACTAGAAGCCACCGAGGATGGCCGCGGTGGCGGCTCCAAGGCGGCCACAC
AGTCCAGGATCGACAGTCCAGACCGCAAAGGTAGGGCACGTCAAGCCAACTCTGCAGAGCCTGGAGGCAAGCGAG
TGCCGGTGAACGAGGACTATCTGTTCGACGTTGATATCGAAGAGCGAGAACTCGAGCCCGTATACTGGCTAGGTC
CCATCTACGAAGGTGCATGCCACGCTATAGCTCCTAGGTTCGACGAGACGCTGACGGATGAGCCAGTTCGCCGAG
GCACATGGTTCTTTCAAGAGGGCTCAAATCTACGACCATGCGAGGAGAATCTGGCGGCTCAGCTGGAAGAGGTAG
TGACCTTGGTATTCACTCTATAGACGAGTCTCTGACATGTGGCACAGGGTTACCTCAAGATGAAGCCGTGGCTGT
TTTCAGGTAGGTAAACTGATTGATAGCTTGCGCCGCCAGCGTCGTGCTGAGACCTAGCGATAGCATCCCCTCGGA
GTCAGGCGGCCGGGACAGAGACGCCAAAAAGCGACTCAAGCGTCGTCTTCAAGAAGCAGACGTCCGCTGGCACGT
CGACACCCAAGACGACGCAGGAGCCAGAGTCTGGTCCGTCTACACCGCCTCAGTTGGCCACGACGCACACGCCGC
AACCGTATCGGCTGTTCGGCGCATACATGAGCAGCGTTGCCACTTACCCAGACGCAAATACAGCCTGGCTGTGCA
GCGACGGCGTTCTTTCCTGGGTCACGACGTCTGTCTACGAAAGGTTCGCCGGAGGTGGCTACATGAGCGGCGCCA
AGCTCGTCAGGGGATATACCGAAGCCAACAAGGCCAAGGAGAAGGAGAAGGACGACAGAAACCAGGATGTGTCGG
CCAAGACCGACGACGGACCGGAAAAGGATTCGTCTATGGGCGCAAGCGATGATGATGTTGTGAACCGGCAAGCCA
CACTGCAGCGACAGCTCTCGTCTCTGATTGAGAACGAGGCCGAGAGCGAGGAGCAAATACGGAAACGCGAGGAGC
AGGAGATCCGGGATGACTACAACGCACAGGACGGCGAATCTCAGGGCCGCGAGATCGATCACCTGGTGCTGGTGA
CGCACGGCATCGGCCAACGACTCGGCCTCCGGTACGCTCTGAATCTCTCAACATCTTAGGACTTGCTGCTGACTG
GCATTGATCAAGGATGGAGAGCGTCAACTTTGTCCACGACGTCAACGTGCTGCGCCAGACTCTCAAGTCTGTTTA
CGCCAACTCGGCCGACCTGAAGGCGCTGAATTCCAAGGGCGACCCGGGAGACTGTCGGGTGCAGGTGTTGCCGGT
CTGCTGGAGGCATCTGTTCGAGTTTCCGAAGCAGCGCCAGCGCAAGGCCGAGTATGACCTGGGCGATCTCGCGGG
CGAGGAGGACAGATGTGAGCCGATGTTTCGACTGTAAAGGGAAGCTTATATCGAGGTAGAAGCTGACCAAGGTTC
GCCTGCAGATCCGTCACTGGACGACATCACGGTCGAGGGCGTCGCCTTTGCGCGGTCTCTCATCTCGGATCTAGC
CCTGGACGTGCTTCTATACCAGAGCTCGTATCGCGACGAGATCTCCAAGGCCGTCGTCGGCGAGGCGAATCGCAT
CGTCGGTCTGTTCCGGCAGAGAAATGCCGACTTCAAGGGAAAGGTGCATTTGATGGGTCATTCGCTGGGCTCGGC
CATCTTCTTTGACGTCTTGTGTCGGCAAAAGGACGAAGCAGCCGGTGGTCAGGGGCATAATCCGCTAAGCTTCTG
GCCTCGTCAGGGCCGTCAGAAGCCCAAGCAGGGCGACCTCCAGTTCGATTTTGACGTTCACGACTACTTTTGTCT
GGGCTCGCCCGTCGGCCTGTTCCAGATGCTTAAGGGGCGGTATGGGCCTCCCAGGATGTCCCCCCCTGAAGATGA
TCTCCTTGGCTGACGAACGACGCCTGCCTACTCAGGACCATTGCTGCTCGACGACCGGCTCGCAACGACGCCTAT
CACGCGGCAGAAGCCGACGCGTCATGTTCCGGTCGTGGAATATCGTCGTCGGTATCTTCGCCCAAGGTCGGACAA
CTCTTCAACATCTTTCACCCGTCAGACCCCATCAGCTACCGCCTCGAGCCCCTCATCTCTACCGCCATGGCGACT
CTCAAGCCGCAAGCGCTGCCCTACACCAAACGCGGCATCTTCGACAGCGTCGCGCCACAAGGCCTGACGGGCTTG
GGCGCAAAAGTAGGCCAGAGCGTCAGCGGCCTTTGGTCCAGCCTCAGCGCCGGCATCGCAAGCAATCTGCTGAAC
CGGAGTCTGGGCCTCACCGCCGACGAGGTGACTCGCATCGCAGCGGAGGAATCTGCCCGCCATGGCAGTCATGAC
GGCCGAGGTGACAGCCGTCAAGTCGCATCTCGGACCGGCGCCGCTCCCTCATCGGCCGCCGAGACGGACAGACGG
AAGCAGAAGCTCGCAGATGCGCCGGCTACGGGCGATCACGGAGACGTCCTCATCGACGGCGAACTGGAGACGCTC
TACGCTCGGTTTCAGAACGGTAGAGCCGTCGCCTCTGGCTCGGATGGCGATTCTTCGAGGGCTCGCAGGATGCGG
ACTGAGGAGATGCGCGTGAGGGCTCTGAATCGCAACGGACGCGTCGACTATAGCATTCAAGAGTATGTTTTTTTT
TTTTTTTTTTTTTTATATACGTTATCTCCTTCTCATCACACCCCCCCCTTTTTTCCCCTGTTGCGCTACGACTAC
GAGACTGACGCCGCATAGGAGCGCCCTCGATTTCAACCCCATCAACACCATTGCCTCGCACATGGGCTACTGGGC
CGACGAGGACGTCAACCACTTTATCCTCTCGCAGCTGCTATCCAGCCGTCCGCGGTCGACGACGACGACGACGAC
GACGACGACGACGACGACGGTAGACGACGCCATGGATATAACGAGCGCGCCACACGGCGACTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail