Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02489
Gene name
Locationscaffold_02:3877946..3880164
Strand+
Gene length (bp)2218
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 8.2E-46 373 599

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 160 179 19
2 194 216 22
3 398 420 22
4 448 470 22
5 577 599 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02489
MTSSQATTSQVQSPTSQNGNPRPLRPSPPDSDTPSEEDYDDNVRPALSSAVRRRPVPKRPGRILDDDDNGIQDLL
RRSSERAKDPKRSRRKFVELVFTHRFSAFDPYNAAAANSPFHGFYNLFWLTVAFFLFKISTDNWHQYGTPLGPTD
ILKTMFRRDVFVLLLSDGIMCGLTGVSWLLQKLVFYRWLSWDGAGWIVQHMWQTTFIAGVVSWTLVRDWPWTHTI
YFVLHGLTMLMKQHSYAFYNGYLSTVYEKRQLLLSRLELLDVANAASSPTATWPPAAAVDTSHLGEPPSGAAQRR
HSLSQPPDDSDIDKIADAIATRQPLDDQQIRLFGRIIKWEVDALADELRGIAVDASSAYPNNLTFANHYKWIPLP
TVVYELEYPRLPAIRWSYVMEKLVAMVGIIFVMIQISQYSIYPVVMKTVEMKESGMPLVARIKEFPRLLSDMLFP
FMMEYLLAWYLIWETVLNVLAELTRFADRTFYGPWWNSVSWDQFARDWNRPVHFFLLRHVYHSSISSMKVNKHTA
TLITFFFSACVHELVMWCLFKKLRGYLLGFQMLQLPLVWLSRTRAFKGRETLGNVMFWAGIFMCPSLLCSLYLVL
*
Coding >Ophcf2|02489
ATGACCTCATCCCAAGCCACGACATCCCAAGTCCAGTCTCCAACCAGCCAGAACGGTAACCCTCGACCTCTGCGC
CCTTCGCCCCCCGACTCCGATACGCCGAGCGAGGAAGATTACGATGACAATGTCCGTCCTGCCCTCTCGTCCGCC
GTCCGCCGTCGTCCGGTTCCGAAACGACCAGGTCGTATCCTCGACGACGACGACAATGGCATACAGGACCTCTTG
CGCCGCAGCTCAGAACGCGCAAAGGACCCCAAGCGCTCGCGTCGCAAGTTCGTTGAGCTCGTCTTCACCCATCGC
TTCTCCGCCTTTGACCCTTACAATGCCGCCGCCGCCAACAGCCCTTTTCATGGCTTCTACAACCTCTTCTGGCTG
ACCGTTGCCTTTTTCCTCTTCAAGATTTCCACCGACAACTGGCACCAGTACGGCACGCCATTGGGTCCCACAGAC
ATCTTGAAGACAATGTTTCGTCGCGACGTATTCGTCCTTCTTCTCTCCGATGGCATCATGTGTGGTCTCACGGGG
GTGAGCTGGCTGCTCCAGAAGCTCGTCTTCTATCGCTGGCTCAGCTGGGACGGTGCGGGCTGGATCGTTCAACAT
ATGTGGCAAACGACCTTTATCGCCGGTGTCGTGAGCTGGACGCTTGTGCGCGACTGGCCTTGGACTCACACCATC
TACTTTGTCCTTCACGGACTCACCATGCTCATGAAACAACACTCATACGCCTTCTACAATGGATATCTGTCTACT
GTTTACGAGAAGCGTCAGCTTCTTCTGTCCAGGCTCGAGTTGCTCGATGTCGCCAACGCAGCCTCCAGCCCCACC
GCAACATGGCCCCCAGCCGCAGCCGTCGACACATCACACCTCGGCGAGCCCCCCTCGGGCGCGGCCCAGCGACGG
CATTCCCTATCGCAACCACCCGACGATTCCGACATCGACAAGATTGCAGACGCTATAGCCACCAGACAGCCGCTT
GACGACCAGCAGATCCGTCTCTTTGGCCGTATCATCAAGTGGGAGGTCGACGCCCTGGCTGATGAGCTGCGCGGA
ATTGCCGTCGACGCCTCCTCTGCGTATCCCAACAACTTGACATTCGCGAACCATTACAAGTGGATTCCGCTACCG
ACCGTCGTCTACGAGCTAGAGTATCCGCGCTTGCCGGCCATTCGCTGGTCATATGTGATGGAGAAGCTGGTCGCC
ATGGTAGGCATCATCTTTGTCATGATACAAATCTCTCAGTATTCCATATACCCGGTCGTCATGAAGACGGTCGAG
ATGAAAGAATCGGGCATGCCGCTCGTCGCAAGAATCAAAGAGTTCCCTCGGCTGCTCAGCGACATGCTGTTCCCG
TTCATGATGGAGTATCTGCTTGCGTGGTATCTGATCTGGGAGACCGTCCTCAACGTCTTAGCCGAGCTCACCCGC
TTCGCCGACCGCACCTTTTACGGCCCGTGGTGGAACAGCGTATCATGGGATCAGTTCGCGCGTGACTGGAACAGG
CCGGTGCACTTCTTCCTCCTCCGGCACGTCTACCACAGCTCCATCTCTTCCATGAAGGTCAACAAGCACACCGCC
ACCCTCATCACCTTCTTCTTCTCCGCCTGCGTCCACGAGCTAGTCATGTGGTGCCTCTTCAAGAAGCTCCGCGGC
TACCTCCTCGGTTTCCAAATGCTGCAGCTACCGCTCGTCTGGCTGAGCCGCACCCGCGCCTTCAAAGGCCGTGAA
ACGCTGGGAAACGTCATGTTCTGGGCTGGCATCTTCATGTGCCCCAGCCTCTTATGCAGCCTTTACCTCGTCCTT
TGA
Transcript >Ophcf2|02489
ATGACCTCATCCCAAGCCACGACATCCCAAGTCCAGTCTCCAACCAGCCAGAACGGTAACCCTCGACCTCTGCGC
CCTTCGCCCCCCGACTCCGATACGCCGAGCGAGGAAGATTACGATGACAATGTCCGTCCTGCCCTCTCGTCCGCC
GTCCGCCGTCGTCCGGTTCCGAAACGACCAGGTCGTATCCTCGACGACGACGACAATGGCATACAGGACCTCTTG
CGCCGCAGCTCAGAACGCGCAAAGGACCCCAAGCGCTCGCGTCGCAAGTTCGTTGAGCTCGTCTTCACCCATCGC
TTCTCCGCCTTTGACCCTTACAATGCCGCCGCCGCCAACAGCCCTTTTCATGGCTTCTACAACCTCTTCTGGCTG
ACCGTTGCCTTTTTCCTCTTCAAGATTTCCACCGACAACTGGCACCAGTACGGCACGCCATTGGGTCCCACAGAC
ATCTTGAAGACAATGTTTCGTCGCGACGTATTCGTCCTTCTTCTCTCCGATGGCATCATGTGTGGTCTCACGGGG
GTGAGCTGGCTGCTCCAGAAGCTCGTCTTCTATCGCTGGCTCAGCTGGGACGGTGCGGGCTGGATCGTTCAACAT
ATGTGGCAAACGACCTTTATCGCCGGTGTCGTGAGCTGGACGCTTGTGCGCGACTGGCCTTGGACTCACACCATC
TACTTTGTCCTTCACGGACTCACCATGCTCATGAAACAACACTCATACGCCTTCTACAATGGATATCTGTCTACT
GTTTACGAGAAGCGTCAGCTTCTTCTGTCCAGGCTCGAGTTGCTCGATGTCGCCAACGCAGCCTCCAGCCCCACC
GCAACATGGCCCCCAGCCGCAGCCGTCGACACATCACACCTCGGCGAGCCCCCCTCGGGCGCGGCCCAGCGACGG
CATTCCCTATCGCAACCACCCGACGATTCCGACATCGACAAGATTGCAGACGCTATAGCCACCAGACAGCCGCTT
GACGACCAGCAGATCCGTCTCTTTGGCCGTATCATCAAGTGGGAGGTCGACGCCCTGGCTGATGAGCTGCGCGGA
ATTGCCGTCGACGCCTCCTCTGCGTATCCCAACAACTTGACATTCGCGAACCATTACAAGTGGATTCCGCTACCG
ACCGTCGTCTACGAGCTAGAGTATCCGCGCTTGCCGGCCATTCGCTGGTCATATGTGATGGAGAAGCTGGTCGCC
ATGGTAGGCATCATCTTTGTCATGATACAAATCTCTCAGTATTCCATATACCCGGTCGTCATGAAGACGGTCGAG
ATGAAAGAATCGGGCATGCCGCTCGTCGCAAGAATCAAAGAGTTCCCTCGGCTGCTCAGCGACATGCTGTTCCCG
TTCATGATGGAGTATCTGCTTGCGTGGTATCTGATCTGGGAGACCGTCCTCAACGTCTTAGCCGAGCTCACCCGC
TTCGCCGACCGCACCTTTTACGGCCCGTGGTGGAACAGCGTATCATGGGATCAGTTCGCGCGTGACTGGAACAGG
CCGGTGCACTTCTTCCTCCTCCGGCACGTCTACCACAGCTCCATCTCTTCCATGAAGGTCAACAAGCACACCGCC
ACCCTCATCACCTTCTTCTTCTCCGCCTGCGTCCACGAGCTAGTCATGTGGTGCCTCTTCAAGAAGCTCCGCGGC
TACCTCCTCGGTTTCCAAATGCTGCAGCTACCGCTCGTCTGGCTGAGCCGCACCCGCGCCTTCAAAGGCCGTGAA
ACGCTGGGAAACGTCATGTTCTGGGCTGGCATCTTCATGTGCCCCAGCCTCTTATGCAGCCTTTACCTCGTCCTT
TGA
Gene >Ophcf2|02489
ATGACCTCATCCCAAGCCACGACATCCCAAGTCCAGTCTCCAACCAGCCAGAACGGTAACCCTCGACCTCTGCGC
CCTTCGCCCCCCGACTCCGATACGCCGAGCGAGGAAGATTACGATGACAATGTCCGTCCTGCCCTCTCGTCCGCC
GTCCGCCGTCGTCCGGTTCCGAAACGACCAGGTCGTATCCTCGACGACGACGACAATGGCATACAGGACCTCTTG
CGCCGCAGCTCAGAACGCGCAAAGGACCCCAAGCGCTCGCGTCGCAAGTTCGTTGAGCTCGTCTTCACCCATCGC
TTCTCCGCCTTTGACCCTTACAATGCCGCCGCCGCCAACAGCCCTTTTCATGGCTTCTACAACCTCTTCTGGCTG
ACCGTTGCCTTTTTCCTCTTCAAGATTTCCACCGACAACTGGCACCAGTACGGCACGCCATTGGGTCCCACAGAC
ATCTTGAAGACAATGTTTCGTCGCGACGGTAGGTGGCTGAGGGGATAGAGTGAGACATTGACTGACTCGTCCAAC
CCCAGTATTCGTCCTTCTTCTCTCCGATGGCATCATGTGTGGTCTCACGGGGGTGAGCTGGCTGCTCCAGAAGCT
CGTCTTCTATCGCTGGCTCAGCTGGGACGGTGCGGGCTGGATCGTTCAACATGTGAGCTCCCCCTTTATCAACTC
GACTCTCCGGCATTATACACCGCCTCTACTTCCACTGACTCAAGCGAGGCAGATGTGGCAAACGACCTTTATCGC
CGGTGTCGTGAGCTGGACGCTTGTGCGCGACTGGCCTTGGACTCACACCATCTACTTTGTCCTTCACGGACTCAC
CATGCTCATGAAACAACACTCATACGCCTTCTACAATGGATATCTGTCTACTGTTTACGAGAAGCGTCAGCTTCT
TCTGTCCAGGCTCGAGTTGCTCGATGTCGCCAACGCAGCCTCCAGCCCCACCGCAACATGGCCCCCAGCCGCAGC
CGTCGACACATCACACCTCGGCGAGCCCCCCTCGGGCGCGGCCCAGCGACGGCATTCCCTATCGCAACCACCCGA
CGATTCCGACATCGACAAGATTGCAGACGCTATAGCCACCAGACAGCCGCTTGACGACCAGCAGATCCGTCTCTT
TGGCCGTATCATCAAGTGGGAGGTCGACGCCCTGGCTGATGAGCTGCGCGGAATTGCCGTCGACGCCTCCTCTGC
GTATCCCAACAACTTGACATTCGCGAACCATTACAAGTGGATTCCGCTACCGACCGTCGTCTACGAGCTAGAGTA
TCCGCGCTTGCCGGCCATTCGCTGGTCATATGTGATGGAGAAGCTGGTCGCCATGGTAGGCATCATCTTTGTCAT
GATACAAATCTCTCAGTATTCCATATGTGGGTTAACCTTTCCCTTTTCTTTGTTGTGCAAGTGAACCGAGACAAA
GGCATTGCTGACCTTTTCCTACAGACCCGGTCGTCATGAAGACGGTCGAGATGAAAGAATCGGGCATGCCGCTCG
TCGCAAGAATCAAAGAGTTCCCTCGGCTGCTCAGCGACATGCTGTTCCCGTTCATGATGGAGTATCTGGTAAGAT
GCCCTCTTGTAACTCCGGCGATGGAGCTGACACGCAACCGAAATCCAGCTTGCGTGGTATCTGATCTGGGAGACC
GTCCTCAACGTCTTAGCCGAGCTCACCCGCTTCGCCGACCGCACCTTTTACGGCCCGTGGTGGAACAGCGGTGCG
TCTCTCACCCCCCCGGGGATCTCATGGCGCCGAATCTCTACTGATCTGTTCTCTTCAACAGTATCATGGGATCAG
TTCGCGCGTGACTGGAACAGGCCGGTGCACTTCTTCCTCCTCCGGCACGTCTACCACAGCTCCATCTCTTCCATG
AAGGTCAACAAGCACACCGCCACCCTCATCACCTTCTTCTTCTCCGCCTGCGTCCACGAGCTAGTCATGTGGTGC
CTCTTCAAGAAGCTCCGCGGCTACCTCCTCGGTTTCCAAATGCTGCAGCTACCGGTACGTTTACATGGAATCACC
CATCTCGCTCGTCTCCAGCCCATTTACTGACCATGCGTTTTTTTTTTTTTTTTTTTTTTCAATTTTCGAATAGCT
CGTCTGGCTGAGCCGCACCCGCGCCTTCAAAGGCCGTGAAACGCTGGGAAACGTCATGTTCTGGGCTGGCATCTT
CATGTGCCCCAGCCTCTTATGCAGCCTTTACCTCGTCCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail