Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02484
Gene name
Locationscaffold_02:3865836..3867046
Strand-
Gene length (bp)1210
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 1.8E-98 44 329

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 188 210 22
2 217 239 22
3 265 287 22
4 300 322 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02484
MRLLKTLVASAFALLAVAENTVDEKASMEKRFVSFHDGIQLAAAPITLNDDAFKKLTAAPRDFTVAVLLTAQGAR
FGCQLCREFQPEWELTARNWAKGDKAGEARLLFATLDFAEGRDTFITLGLQTAPVLLLYPPTHGPHAVTSRDPKR
FDFNSGPPAAEQVHAWIVSYLPGRPHPTFQRPINYLRWASAITALAGVATLAYTAGPYLLPIIQNRQVWATGTMI
AILLFISGHMFNHIRKVPYVSSDGKGGVTYIAPGFQNQYGLETQIVATLYGIMSFCTIALVTRVPRIANRRTQTL
TALAIVAVMFVTNSFILRIFRIKNSGYPFSTPPFM*
Coding >Ophcf2|02484
ATGCGCCTCCTCAAGACGCTCGTCGCCTCAGCCTTCGCGCTCCTGGCCGTCGCCGAAAACACCGTCGATGAAAAG
GCATCAATGGAGAAACGATTCGTCTCCTTCCACGATGGCATTCAGCTCGCGGCCGCGCCCATCACCCTCAACGAC
GACGCCTTCAAGAAGCTTACGGCTGCGCCCCGCGACTTTACCGTCGCTGTTCTCCTCACAGCTCAGGGCGCTCGC
TTCGGCTGCCAGCTCTGCCGTGAGTTTCAGCCTGAGTGGGAGCTTACTGCCAGGAACTGGGCCAAGGGTGACAAG
GCTGGCGAGGCTCGTCTGCTCTTTGCCACGCTCGATTTTGCCGAGGGTCGCGATACTTTCATCACGCTCGGCCTC
CAGACCGCTCCCGTCCTCCTTCTCTACCCCCCCACTCACGGCCCTCATGCCGTCACCTCCCGCGATCCGAAGCGT
TTCGACTTCAACAGCGGCCCTCCGGCTGCAGAACAGGTCCATGCCTGGATCGTCAGCTACCTCCCGGGCCGTCCT
CACCCCACCTTCCAGCGTCCTATCAACTACCTACGCTGGGCTTCGGCCATCACTGCTCTGGCCGGTGTTGCCACT
CTTGCCTACACTGCGGGTCCCTATCTGCTGCCCATCATCCAGAACCGCCAGGTCTGGGCTACCGGCACCATGATT
GCTATTCTTCTCTTCATCAGCGGTCACATGTTCAACCACATCCGCAAGGTGCCCTACGTCTCCAGTGACGGAAAA
GGCGGAGTCACATACATCGCTCCAGGCTTCCAGAATCAGTACGGCCTCGAGACGCAGATTGTCGCCACCCTCTAT
GGCATCATGTCCTTCTGCACCATAGCCCTCGTCACCCGCGTCCCCCGCATCGCCAACCGACGAACCCAGACGTTG
ACGGCCCTGGCCATCGTGGCCGTCATGTTCGTCACCAACAGCTTCATCCTCCGCATCTTCCGCATCAAGAACAGC
GGATACCCCTTCTCCACCCCGCCCTTCATGTAA
Transcript >Ophcf2|02484
ATGCGCCTCCTCAAGACGCTCGTCGCCTCAGCCTTCGCGCTCCTGGCCGTCGCCGAAAACACCGTCGATGAAAAG
GCATCAATGGAGAAACGATTCGTCTCCTTCCACGATGGCATTCAGCTCGCGGCCGCGCCCATCACCCTCAACGAC
GACGCCTTCAAGAAGCTTACGGCTGCGCCCCGCGACTTTACCGTCGCTGTTCTCCTCACAGCTCAGGGCGCTCGC
TTCGGCTGCCAGCTCTGCCGTGAGTTTCAGCCTGAGTGGGAGCTTACTGCCAGGAACTGGGCCAAGGGTGACAAG
GCTGGCGAGGCTCGTCTGCTCTTTGCCACGCTCGATTTTGCCGAGGGTCGCGATACTTTCATCACGCTCGGCCTC
CAGACCGCTCCCGTCCTCCTTCTCTACCCCCCCACTCACGGCCCTCATGCCGTCACCTCCCGCGATCCGAAGCGT
TTCGACTTCAACAGCGGCCCTCCGGCTGCAGAACAGGTCCATGCCTGGATCGTCAGCTACCTCCCGGGCCGTCCT
CACCCCACCTTCCAGCGTCCTATCAACTACCTACGCTGGGCTTCGGCCATCACTGCTCTGGCCGGTGTTGCCACT
CTTGCCTACACTGCGGGTCCCTATCTGCTGCCCATCATCCAGAACCGCCAGGTCTGGGCTACCGGCACCATGATT
GCTATTCTTCTCTTCATCAGCGGTCACATGTTCAACCACATCCGCAAGGTGCCCTACGTCTCCAGTGACGGAAAA
GGCGGAGTCACATACATCGCTCCAGGCTTCCAGAATCAGTACGGCCTCGAGACGCAGATTGTCGCCACCCTCTAT
GGCATCATGTCCTTCTGCACCATAGCCCTCGTCACCCGCGTCCCCCGCATCGCCAACCGACGAACCCAGACGTTG
ACGGCCCTGGCCATCGTGGCCGTCATGTTCGTCACCAACAGCTTCATCCTCCGCATCTTCCGCATCAAGAACAGC
GGATACCCCTTCTCCACCCCGCCCTTCATGTAA
Gene >Ophcf2|02484
ATGCGCCTCCTCAAGACGCTCGTCGCCTCAGCCTTCGCGCTCCTGGCCGTCGCCGAAAACACCGTCGATGAAAAG
GCATCAATGGAGAAACGATTCGTCTCCTTCCACGATGGCATTCAGCTCGCGGCCGCGCCCATCACCCTCAACGAC
GACGCCTTCAAGAAGCTTACGGCTGCGCCCCGCGACTTTACCGTCGCTGTTCTCCTCACAGCTCAGGGCGCTCGC
TTCGGCTGCCAGCTCTGCCGTGAGTTTCAGCCTGAGTGGGAGCTTACTGCCAGGAACTGGGCCAAGGGTGACAAG
GCTGGCGAGGCTCGTCTGCTCTTTGCCACGCTCGATTTTGCCGAGGGTCGCGATACTTTCATCACGGTTCGTCTT
CTTCTTTCATCTTCCTCCTGCTTCCATCCGGTCTTTTTGCTAACCAAAGAAATCCCTCTACAGCTCGGCCTCCAG
ACCGCTCCCGTCCTCCTTCTCTACCCCCCCACTCACGGCCCTCATGCCGTCACCTCCCGCGATCCGAAGCGTTTC
GACTTCAACAGCGGGTCAGTTAGGCGGCGGACCAATATGTACATCGGAAAAGCGCTGACCGAGACCGTCCGCAGC
CCTCCGGCTGCAGAACAGGTCCATGCCTGGATCGTCAGCTACCTCCCGGGCCGTCCTCACCCCACCTTCCAGCGT
CCTATCAACTACCTACGCTGGGCTTCGGCCATCACTGCTCTGGCCGGTGTTGCCACTCTTGCCTACACTGCGGGT
CCCTATCTGCTGCCCATCATCCAGAACCGCCAGGTCTGGGCTACCGGCACCATGATTGCTATTCTTCTCTTCATC
AGCGGTCACATGTTCAACCACATCCGCAAGGTGCCCTACGTCTCCAGTGACGGAAAAGGCGGAGTCACATACATC
GCTCCAGGCTTCCAGAATCAGTACGGCCTCGAGACGCAGATTGTCGCCACCCTCTGTAAGTTTGCCAAGCTCCTG
GCCCATCTCCCTTTCACCCACTTCCTCCAGCAGTGCTAACATGTTGACAGATGGCATCATGTCCTTCTGCACCAT
AGCCCTCGTCACCCGCGTCCCCCGCATCGCCAACCGACGAACCCAGACGTTGACGGCCCTGGCCATCGTGGCCGT
CATGTTCGTCACCAACAGCTTCATCCTCCGCATCTTCCGCATCAAGAACAGCGGATACCCCTTCTCCACCCCGCC
CTTCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail