Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02472
Gene name
Locationscaffold_02:3836886..3838731
Strand-
Gene length (bp)1845
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-36 54 448

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 82 99 17
3 106 128 22
4 143 161 18
5 168 190 22
6 200 219 19
7 236 253 17
8 268 290 22
9 311 333 22
10 343 365 22
11 370 389 19
12 399 421 22
13 433 452 19
14 472 494 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 20.67 10.47 30.88
Alive In ants, during behavior modification 161.40 23.37 299.44
Dead In ants, recently dead 50.33 28.02 72.65

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02472
MMQSTMESVIPEREASEDLPKTIDVERLGRQRPVEFSSTWLEVAFVISMLGALSMADFIIGGFQVVLPALIKPFD
IPSGSQTWPSSVLTLVAGAFLFPLGRLSDMYGGYYIFNGGLVWFTLWTIAAGFTGSFSLLVLCRAMQGLGAAAFL
PAGISLLGRIYRPGPRKNLVFAVYGALAPLGFFLGIIIGGLSQDLLSWRWYFWMGGIITGVCCVGTILTSPRDYA
SARKMKVRMDWWGVSTMVPGLMLFIYAVTESPNAPRGWASPQIVTTLVLGVLFLIAAVYVEGWVATSPLIPGDIF
RVKYMKRMLLCLVLSWGVFSMYSFYSNFYIQLILGRSALTTAVWYSPWAVGGLVLSIMSGFILHILPGRVLLIMC
GMSKVLAVLFFALMPENPNYWAWVFPAMLCEAACVDVLWTVSNVFLTTSLPRHRQGLAGALISVTLFLGGALFLA
VADVVKEQLRTAGFDLKKQYKGIFWIGVGFAGISLCICCFIRLGQAGCALTLEERQEVALDDIDDEKDQTRREVR
TSESDTETVVGVEAGADTDKKKA*
Coding >Ophcf2|02472
ATGATGCAGTCCACCATGGAGTCTGTTATCCCGGAGCGAGAGGCCTCGGAAGACCTGCCCAAGACGATTGACGTC
GAGAGGCTTGGTCGCCAACGGCCAGTCGAGTTCTCGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTT
GGGGCCCTCTCTATGGCTGACTTTATCATTGGCGGTTTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCATTTGAT
ATCCCTTCGGGCTCCCAGACCTGGCCCTCGAGCGTCCTGACCCTTGTCGCTGGTGCATTTCTCTTTCCGCTCGGC
CGACTGAGTGACATGTACGGCGGCTACTACATCTTCAACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCC
GCTGGCTTCACCGGCAGCTTCTCCCTGCTCGTGCTCTGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTC
CCCGCCGGCATCTCCCTGTTGGGTCGCATCTACCGTCCCGGTCCCCGCAAGAACCTCGTCTTCGCCGTCTACGGC
GCCCTCGCCCCCCTGGGCTTCTTCCTCGGCATCATCATCGGCGGCCTGTCCCAGGACCTGCTGTCATGGAGGTGG
TACTTTTGGATGGGAGGCATCATCACCGGTGTCTGCTGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCC
TCAGCCCGCAAGATGAAGGTCCGCATGGACTGGTGGGGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATC
TACGCCGTCACCGAGAGCCCCAACGCGCCCAGGGGATGGGCCTCGCCTCAGATCGTCACCACGTTGGTTCTCGGC
GTCTTGTTCCTCATCGCCGCCGTCTATGTAGAGGGCTGGGTCGCCACGTCGCCACTGATACCGGGCGACATCTTC
CGCGTCAAGTACATGAAGAGGATGCTTCTCTGCCTCGTACTTTCATGGGGCGTCTTTTCCATGTACTCGTTTTAC
TCCAATTTCTATATTCAGCTGATTCTGGGTCGCTCCGCTCTCACCACGGCCGTCTGGTACAGCCCCTGGGCTGTC
GGTGGACTCGTCTTGTCCATCATGAGCGGCTTCATCCTGCACATCCTTCCAGGACGCGTGCTGCTCATCATGTGC
GGCATGTCCAAGGTGCTGGCCGTCTTATTCTTCGCCCTGATGCCAGAAAACCCCAACTACTGGGCATGGGTGTTT
CCGGCCATGCTGTGCGAGGCGGCATGCGTCGACGTGCTGTGGACAGTGAGCAACGTCTTCCTCACGACCAGCCTG
CCGCGCCATCGTCAGGGACTGGCGGGCGCCCTCATCAGCGTAACGCTGTTCCTTGGCGGCGCCCTGTTCCTCGCC
GTGGCCGACGTGGTCAAGGAGCAGCTCCGGACGGCGGGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGG
ATCGGCGTGGGCTTCGCCGGCATCTCTCTATGCATCTGCTGCTTCATCCGGCTTGGCCAGGCCGGCTGCGCGCTG
ACTCTGGAGGAGAGGCAGGAGGTCGCCCTGGATGATATCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGG
ACAAGCGAGTCCGACACCGAGACGGTCGTCGGCGTCGAGGCCGGGGCCGACACTGACAAGAAGAAGGCTTGA
Transcript >Ophcf2|02472
ATGATGCAGTCCACCATGGAGTCTGTTATCCCGGAGCGAGAGGCCTCGGAAGACCTGCCCAAGACGATTGACGTC
GAGAGGCTTGGTCGCCAACGGCCAGTCGAGTTCTCGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTT
GGGGCCCTCTCTATGGCTGACTTTATCATTGGCGGTTTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCATTTGAT
ATCCCTTCGGGCTCCCAGACCTGGCCCTCGAGCGTCCTGACCCTTGTCGCTGGTGCATTTCTCTTTCCGCTCGGC
CGACTGAGTGACATGTACGGCGGCTACTACATCTTCAACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCC
GCTGGCTTCACCGGCAGCTTCTCCCTGCTCGTGCTCTGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTC
CCCGCCGGCATCTCCCTGTTGGGTCGCATCTACCGTCCCGGTCCCCGCAAGAACCTCGTCTTCGCCGTCTACGGC
GCCCTCGCCCCCCTGGGCTTCTTCCTCGGCATCATCATCGGCGGCCTGTCCCAGGACCTGCTGTCATGGAGGTGG
TACTTTTGGATGGGAGGCATCATCACCGGTGTCTGCTGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCC
TCAGCCCGCAAGATGAAGGTCCGCATGGACTGGTGGGGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATC
TACGCCGTCACCGAGAGCCCCAACGCGCCCAGGGGATGGGCCTCGCCTCAGATCGTCACCACGTTGGTTCTCGGC
GTCTTGTTCCTCATCGCCGCCGTCTATGTAGAGGGCTGGGTCGCCACGTCGCCACTGATACCGGGCGACATCTTC
CGCGTCAAGTACATGAAGAGGATGCTTCTCTGCCTCGTACTTTCATGGGGCGTCTTTTCCATGTACTCGTTTTAC
TCCAATTTCTATATTCAGCTGATTCTGGGTCGCTCCGCTCTCACCACGGCCGTCTGGTACAGCCCCTGGGCTGTC
GGTGGACTCGTCTTGTCCATCATGAGCGGCTTCATCCTGCACATCCTTCCAGGACGCGTGCTGCTCATCATGTGC
GGCATGTCCAAGGTGCTGGCCGTCTTATTCTTCGCCCTGATGCCAGAAAACCCCAACTACTGGGCATGGGTGTTT
CCGGCCATGCTGTGCGAGGCGGCATGCGTCGACGTGCTGTGGACAGTGAGCAACGTCTTCCTCACGACCAGCCTG
CCGCGCCATCGTCAGGGACTGGCGGGCGCCCTCATCAGCGTAACGCTGTTCCTTGGCGGCGCCCTGTTCCTCGCC
GTGGCCGACGTGGTCAAGGAGCAGCTCCGGACGGCGGGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGG
ATCGGCGTGGGCTTCGCCGGCATCTCTCTATGCATCTGCTGCTTCATCCGGCTTGGCCAGGCCGGCTGCGCGCTG
ACTCTGGAGGAGAGGCAGGAGGTCGCCCTGGATGATATCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGG
ACAAGCGAGTCCGACACCGAGACGGTCGTCGGCGTCGAGGCCGGGGCCGACACTGACAAGAAGAAGGCTTGA
Gene >Ophcf2|02472
ATGATGCAGTCCACCATGGAGTCTGTTATCCCGGAGCGAGAGGCCTCGGAAGACCTGCCCAAGACGATTGACGTC
GAGAGGCTTGGTCGCCAACGGCCAGTCGAGTTCTCGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTT
GGGGCCCTCTCTATGGCTGTGGGTGCCTTGTACATACGCTGCTTCTTGAACGCTCGCCAACTTTCACTCTCACAC
ACTCTCTCCGACTCCCTCGTGAAGATGGAGCGGCTTGCTGATCCGCACCGCTCACGCAGGACTTTATCATTGGCG
GTTTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCATTTGATATCCCTTCGGGCTCCCAGACCTGGCCCTCGAGCG
TCCTGACCCTTGTCGCTGGTGCATTTCTCTTTCCGCTCGGCCGACTGAGTGACATGTACGGCGGCTACTACATCT
TCAACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCCGCTGGCTTCACCGGCAGCTTCTCCCTGCTCGTGC
TCTGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTCCCCGCCGGCATCTCCCTGTTGGGTCGCATCTACC
GTCCCGGTCCCCGCAAGAACCTCGTCTTCGCCGTCTACGGCGCCCTCGCCCCCCTGGGCTTCTTCCTCGGCATCA
TCATCGGCGGCCTGTCCCAGGACCTGCTGTCATGGAGGTGGTACTTTTGGATGGGAGGCATCATCACCGGTGTCT
GCTGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCCTCAGCCCGCAAGATGAAGGTCCGCATGGACTGGT
GGGGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATCTACGCCGTCACCGAGAGCCCCAACGCGCCCAGGG
GATGGGCCTCGCCTCAGATCGTCACCACGTTGGTTCTCGGCGTCTTGTTCCTCATCGCCGCCGTCTATGTAGAGG
GCTGGGTCGCCACGTCGCCACTGATACCGGGCGACATCTTCCGCGTCAAGTACATGAAGAGGATGCTTCTCTGCC
TCGTACTTTCATGGGGCGTCTTTTCCATGTACTCGTTTTACTCCAATTTCTAGTGAGTGCCGGAAGAGACAGAGA
GCGAGACACCAAGAGAGAGGCGAGTTGAAAGACAACGAGGCTGACTTTGACACTATCAGTATTCAGCTGATTCTG
GGTCGCTCCGCTCTCACCACGGCCGTCTGGTACAGCCCCTGGGCTGTCGGTGGACTCGTCTTGTCCATCATGAGC
GGCTTCATCCTGCACATCCTTCCAGGACGCGTGCTGCTCATCATGTGCGGCATGTCCAAGGTGCTGGCCGTCTTA
TTCTTCGCCCTGATGCCAGAAAACCCCAACTACTGGGCATGGGTGTTTCCGGCCATGCTGTGCGAGGCGGCATGC
GTCGACGTGCTGTGGACAGTGAGCAACGTCTTCCTCACGACCAGCCTGCCGCGCCATCGTCAGGGACTGGCGGGC
GCCCTCATCAGCGTAACGCTGTTCCTTGGCGGCGCCCTGTTCCTCGCCGTGGCCGACGTGGTCAAGGAGCAGCTC
CGGACGGCGGGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGGATCGGCGTGGGCTTCGCCGGCATCTCT
CTATGCATCTGCTGCTTCATCCGGCTTGGCCAGGCCGGCTGCGCGCTGACTCTGGAGGAGAGGCAGGAGGTCGCC
CTGGATGATATCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGGACAAGCGAGTCCGACACCGAGACGGTC
GTCGGCGTCGAGGCCGGGGCCGACACTGACAAGAAGAAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail