Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02472
Gene name
Locationscaffold_02:3836886..3838731
Strand-
Gene length (bp)1845
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-36 54 448

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 82 99 17
3 106 128 22
4 143 161 18
5 168 190 22
6 200 219 19
7 236 253 17
8 268 290 22
9 311 333 22
10 343 365 22
11 370 389 19
12 399 421 22
13 433 452 19
14 472 494 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02472
MMQSTMESVIPEREASEDLPKTIDVERLGRQRPVEFSSTWLEVAFVISMLGALSMADFIIGGFQVVLPALIKPFD
IPSGSQTWPSSVLTLVAGAFLFPLGRLSDMYGGYYIFNGGLVWFTLWTIAAGFTGSFSLLVLCRAMQGLGAAAFL
PAGISLLGRIYRPGPRKNLVFAVYGALAPLGFFLGIIIGGLSQDLLSWRWYFWMGGIITGVCCVGTILTSPRDYA
SARKMKVRMDWWGVSTMVPGLMLFIYAVTESPNAPRGWASPQIVTTLVLGVLFLIAAVYVEGWVATSPLIPGDIF
RVKYMKRMLLCLVLSWGVFSMYSFYSNFYIQLILGRSALTTAVWYSPWAVGGLVLSIMSGFILHILPGRVLLIMC
GMSKVLAVLFFALMPENPNYWAWVFPAMLCEAACVDVLWTVSNVFLTTSLPRHRQGLAGALISVTLFLGGALFLA
VADVVKEQLRTAGFDLKKQYKGIFWIGVGFAGISLCICCFIRLGQAGCALTLEERQEVALDDIDDEKDQTRREVR
TSESDTETVVGVEAGADTDKKKA*
Coding >Ophcf2|02472
ATGATGCAGTCCACCATGGAGTCTGTTATCCCGGAGCGAGAGGCCTCGGAAGACCTGCCCAAGACGATTGACGTC
GAGAGGCTTGGTCGCCAACGGCCAGTCGAGTTCTCGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTT
GGGGCCCTCTCTATGGCTGACTTTATCATTGGCGGTTTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCATTTGAT
ATCCCTTCGGGCTCCCAGACCTGGCCCTCGAGCGTCCTGACCCTTGTCGCTGGTGCATTTCTCTTTCCGCTCGGC
CGACTGAGTGACATGTACGGCGGCTACTACATCTTCAACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCC
GCTGGCTTCACCGGCAGCTTCTCCCTGCTCGTGCTCTGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTC
CCCGCCGGCATCTCCCTGTTGGGTCGCATCTACCGTCCCGGTCCCCGCAAGAACCTCGTCTTCGCCGTCTACGGC
GCCCTCGCCCCCCTGGGCTTCTTCCTCGGCATCATCATCGGCGGCCTGTCCCAGGACCTGCTGTCATGGAGGTGG
TACTTTTGGATGGGAGGCATCATCACCGGTGTCTGCTGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCC
TCAGCCCGCAAGATGAAGGTCCGCATGGACTGGTGGGGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATC
TACGCCGTCACCGAGAGCCCCAACGCGCCCAGGGGATGGGCCTCGCCTCAGATCGTCACCACGTTGGTTCTCGGC
GTCTTGTTCCTCATCGCCGCCGTCTATGTAGAGGGCTGGGTCGCCACGTCGCCACTGATACCGGGCGACATCTTC
CGCGTCAAGTACATGAAGAGGATGCTTCTCTGCCTCGTACTTTCATGGGGCGTCTTTTCCATGTACTCGTTTTAC
TCCAATTTCTATATTCAGCTGATTCTGGGTCGCTCCGCTCTCACCACGGCCGTCTGGTACAGCCCCTGGGCTGTC
GGTGGACTCGTCTTGTCCATCATGAGCGGCTTCATCCTGCACATCCTTCCAGGACGCGTGCTGCTCATCATGTGC
GGCATGTCCAAGGTGCTGGCCGTCTTATTCTTCGCCCTGATGCCAGAAAACCCCAACTACTGGGCATGGGTGTTT
CCGGCCATGCTGTGCGAGGCGGCATGCGTCGACGTGCTGTGGACAGTGAGCAACGTCTTCCTCACGACCAGCCTG
CCGCGCCATCGTCAGGGACTGGCGGGCGCCCTCATCAGCGTAACGCTGTTCCTTGGCGGCGCCCTGTTCCTCGCC
GTGGCCGACGTGGTCAAGGAGCAGCTCCGGACGGCGGGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGG
ATCGGCGTGGGCTTCGCCGGCATCTCTCTATGCATCTGCTGCTTCATCCGGCTTGGCCAGGCCGGCTGCGCGCTG
ACTCTGGAGGAGAGGCAGGAGGTCGCCCTGGATGATATCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGG
ACAAGCGAGTCCGACACCGAGACGGTCGTCGGCGTCGAGGCCGGGGCCGACACTGACAAGAAGAAGGCTTGA
Transcript >Ophcf2|02472
ATGATGCAGTCCACCATGGAGTCTGTTATCCCGGAGCGAGAGGCCTCGGAAGACCTGCCCAAGACGATTGACGTC
GAGAGGCTTGGTCGCCAACGGCCAGTCGAGTTCTCGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTT
GGGGCCCTCTCTATGGCTGACTTTATCATTGGCGGTTTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCATTTGAT
ATCCCTTCGGGCTCCCAGACCTGGCCCTCGAGCGTCCTGACCCTTGTCGCTGGTGCATTTCTCTTTCCGCTCGGC
CGACTGAGTGACATGTACGGCGGCTACTACATCTTCAACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCC
GCTGGCTTCACCGGCAGCTTCTCCCTGCTCGTGCTCTGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTC
CCCGCCGGCATCTCCCTGTTGGGTCGCATCTACCGTCCCGGTCCCCGCAAGAACCTCGTCTTCGCCGTCTACGGC
GCCCTCGCCCCCCTGGGCTTCTTCCTCGGCATCATCATCGGCGGCCTGTCCCAGGACCTGCTGTCATGGAGGTGG
TACTTTTGGATGGGAGGCATCATCACCGGTGTCTGCTGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCC
TCAGCCCGCAAGATGAAGGTCCGCATGGACTGGTGGGGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATC
TACGCCGTCACCGAGAGCCCCAACGCGCCCAGGGGATGGGCCTCGCCTCAGATCGTCACCACGTTGGTTCTCGGC
GTCTTGTTCCTCATCGCCGCCGTCTATGTAGAGGGCTGGGTCGCCACGTCGCCACTGATACCGGGCGACATCTTC
CGCGTCAAGTACATGAAGAGGATGCTTCTCTGCCTCGTACTTTCATGGGGCGTCTTTTCCATGTACTCGTTTTAC
TCCAATTTCTATATTCAGCTGATTCTGGGTCGCTCCGCTCTCACCACGGCCGTCTGGTACAGCCCCTGGGCTGTC
GGTGGACTCGTCTTGTCCATCATGAGCGGCTTCATCCTGCACATCCTTCCAGGACGCGTGCTGCTCATCATGTGC
GGCATGTCCAAGGTGCTGGCCGTCTTATTCTTCGCCCTGATGCCAGAAAACCCCAACTACTGGGCATGGGTGTTT
CCGGCCATGCTGTGCGAGGCGGCATGCGTCGACGTGCTGTGGACAGTGAGCAACGTCTTCCTCACGACCAGCCTG
CCGCGCCATCGTCAGGGACTGGCGGGCGCCCTCATCAGCGTAACGCTGTTCCTTGGCGGCGCCCTGTTCCTCGCC
GTGGCCGACGTGGTCAAGGAGCAGCTCCGGACGGCGGGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGG
ATCGGCGTGGGCTTCGCCGGCATCTCTCTATGCATCTGCTGCTTCATCCGGCTTGGCCAGGCCGGCTGCGCGCTG
ACTCTGGAGGAGAGGCAGGAGGTCGCCCTGGATGATATCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGG
ACAAGCGAGTCCGACACCGAGACGGTCGTCGGCGTCGAGGCCGGGGCCGACACTGACAAGAAGAAGGCTTGA
Gene >Ophcf2|02472
ATGATGCAGTCCACCATGGAGTCTGTTATCCCGGAGCGAGAGGCCTCGGAAGACCTGCCCAAGACGATTGACGTC
GAGAGGCTTGGTCGCCAACGGCCAGTCGAGTTCTCGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTT
GGGGCCCTCTCTATGGCTGTGGGTGCCTTGTACATACGCTGCTTCTTGAACGCTCGCCAACTTTCACTCTCACAC
ACTCTCTCCGACTCCCTCGTGAAGATGGAGCGGCTTGCTGATCCGCACCGCTCACGCAGGACTTTATCATTGGCG
GTTTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCATTTGATATCCCTTCGGGCTCCCAGACCTGGCCCTCGAGCG
TCCTGACCCTTGTCGCTGGTGCATTTCTCTTTCCGCTCGGCCGACTGAGTGACATGTACGGCGGCTACTACATCT
TCAACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCCGCTGGCTTCACCGGCAGCTTCTCCCTGCTCGTGC
TCTGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTCCCCGCCGGCATCTCCCTGTTGGGTCGCATCTACC
GTCCCGGTCCCCGCAAGAACCTCGTCTTCGCCGTCTACGGCGCCCTCGCCCCCCTGGGCTTCTTCCTCGGCATCA
TCATCGGCGGCCTGTCCCAGGACCTGCTGTCATGGAGGTGGTACTTTTGGATGGGAGGCATCATCACCGGTGTCT
GCTGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCCTCAGCCCGCAAGATGAAGGTCCGCATGGACTGGT
GGGGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATCTACGCCGTCACCGAGAGCCCCAACGCGCCCAGGG
GATGGGCCTCGCCTCAGATCGTCACCACGTTGGTTCTCGGCGTCTTGTTCCTCATCGCCGCCGTCTATGTAGAGG
GCTGGGTCGCCACGTCGCCACTGATACCGGGCGACATCTTCCGCGTCAAGTACATGAAGAGGATGCTTCTCTGCC
TCGTACTTTCATGGGGCGTCTTTTCCATGTACTCGTTTTACTCCAATTTCTAGTGAGTGCCGGAAGAGACAGAGA
GCGAGACACCAAGAGAGAGGCGAGTTGAAAGACAACGAGGCTGACTTTGACACTATCAGTATTCAGCTGATTCTG
GGTCGCTCCGCTCTCACCACGGCCGTCTGGTACAGCCCCTGGGCTGTCGGTGGACTCGTCTTGTCCATCATGAGC
GGCTTCATCCTGCACATCCTTCCAGGACGCGTGCTGCTCATCATGTGCGGCATGTCCAAGGTGCTGGCCGTCTTA
TTCTTCGCCCTGATGCCAGAAAACCCCAACTACTGGGCATGGGTGTTTCCGGCCATGCTGTGCGAGGCGGCATGC
GTCGACGTGCTGTGGACAGTGAGCAACGTCTTCCTCACGACCAGCCTGCCGCGCCATCGTCAGGGACTGGCGGGC
GCCCTCATCAGCGTAACGCTGTTCCTTGGCGGCGCCCTGTTCCTCGCCGTGGCCGACGTGGTCAAGGAGCAGCTC
CGGACGGCGGGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGGATCGGCGTGGGCTTCGCCGGCATCTCT
CTATGCATCTGCTGCTTCATCCGGCTTGGCCAGGCCGGCTGCGCGCTGACTCTGGAGGAGAGGCAGGAGGTCGCC
CTGGATGATATCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGGACAAGCGAGTCCGACACCGAGACGGTC
GTCGGCGTCGAGGCCGGGGCCGACACTGACAAGAAGAAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail