Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02465
Gene name
Locationscaffold_02:3821610..3823282
Strand-
Gene length (bp)1672
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 1.2E-25 41 156
PF08241 Methyltransf_11 Methyltransferase domain 1.2E-24 45 143
PF13649 Methyltransf_25 Methyltransferase domain 2.6E-24 44 139
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.1E-18 41 162
PF13489 Methyltransf_23 Methyltransferase domain 1.1E-16 33 192
PF08242 Methyltransf_12 Methyltransferase domain 1.3E-14 45 140
PF02390 Methyltransf_4 Putative methyltransferase 6.8E-07 42 109
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.8E-06 32 110
PF05175 MTS Methyltransferase small domain 2.7E-06 31 100
PF07021 MetW Methionine biosynthesis protein MetW 1.4E-05 40 136

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity Yes
GO:0006400 tRNA modification Yes
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043170 macromolecule metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0008033 tRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008173 RNA methyltransferase activity No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0034470 ncRNA processing No
GO:0071704 organic substance metabolic process No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0006399 tRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0009451 RNA modification No
GO:0043412 macromolecule modification No
GO:0003824 catalytic activity No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008175 tRNA methyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6812 0.5484 0.2432 0.0402 0.1492 0.1259 0.1623 0.1812 0.3655 0.0328

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup214
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4723
Ophiocordyceps australis map64 (Brazil) OphauB2|2906
Ophiocordyceps camponoti-floridani Ophcf2|02465 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02470
Ophiocordyceps camponoti-rufipedis Ophun1|5445
Ophiocordyceps camponoti-rufipedis Ophun1|5450
Ophiocordyceps kimflemingae Ophio5|3934
Ophiocordyceps kimflemingae Ophio5|7220
Ophiocordyceps subramaniannii Hirsu2|1869
Ophiocordyceps subramaniannii Hirsu2|6618
Ophiocordyceps subramaniannii Hirsu2|8995

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02465
MEPVKEEHVYSTDHSDSVLRTHRWRTLANSAGYLLPHLLPDMMVLDVGCGPGSITIDLARAVPEGHVTGVEYVSD
PLDGARADARAQAITNVSFSVADAHHLPFPDASFHVVHAHQVLQHLADPVQALREMRRVVRPGGLVACRESASMT
WHPESKGIEAWLQLTTRVAREKGGNPHPGSRIHVWAEQAGFATESIDKSAGAWNKSKLWLGMMLAIRVWVSEPAR
TEKRLDRWK*
Coding >Ophcf2|02465
ATGGAACCCGTCAAGGAGGAACACGTCTACTCGACTGATCACTCGGACTCTGTCCTACGTACTCACCGCTGGCGT
ACCCTCGCCAACTCGGCTGGCTATTTACTCCCTCATCTTCTGCCGGACATGATGGTTCTCGACGTCGGTTGCGGG
CCGGGCTCTATCACTATCGATCTGGCGAGGGCCGTCCCCGAGGGCCATGTTACGGGCGTCGAGTACGTATCCGAT
CCGCTTGACGGTGCCCGAGCAGACGCCCGGGCTCAGGCCATCACCAACGTCTCCTTCAGCGTGGCCGACGCTCAT
CATCTGCCCTTCCCGGACGCTTCTTTCCATGTCGTTCACGCCCATCAGGTACTACAGCATCTTGCCGATCCCGTC
CAGGCTTTGCGTGAGATGCGTCGCGTCGTGAGACCAGGAGGTCTCGTCGCCTGCCGCGAATCAGCCTCGATGACA
TGGCACCCCGAATCCAAAGGTATAGAAGCCTGGCTACAGCTGACGACGCGCGTGGCCCGTGAGAAGGGTGGGAAT
CCGCACCCTGGCAGTCGGATTCACGTGTGGGCTGAGCAGGCTGGTTTCGCGACCGAATCAATCGACAAGAGCGCT
GGGGCCTGGAACAAGAGCAAGCTATGGTTAGGAATGATGCTTGCCATTCGAGTCTGGGTTTCTGAGCCAGCTAGA
ACGGAAAAGAGGCTGGATCGGTGGAAGTGA
Transcript >Ophcf2|02465
ATGGAACCCGTCAAGGAGGAACACGTCTACTCGACTGATCACTCGGACTCTGTCCTACGTACTCACCGCTGGCGT
ACCCTCGCCAACTCGGCTGGCTATTTACTCCCTCATCTTCTGCCGGACATGATGGTTCTCGACGTCGGTTGCGGG
CCGGGCTCTATCACTATCGATCTGGCGAGGGCCGTCCCCGAGGGCCATGTTACGGGCGTCGAGTACGTATCCGAT
CCGCTTGACGGTGCCCGAGCAGACGCCCGGGCTCAGGCCATCACCAACGTCTCCTTCAGCGTGGCCGACGCTCAT
CATCTGCCCTTCCCGGACGCTTCTTTCCATGTCGTTCACGCCCATCAGGTACTACAGCATCTTGCCGATCCCGTC
CAGGCTTTGCGTGAGATGCGTCGCGTCGTGAGACCAGGAGGTCTCGTCGCCTGCCGCGAATCAGCCTCGATGACA
TGGCACCCCGAATCCAAAGGTATAGAAGCCTGGCTACAGCTGACGACGCGCGTGGCCCGTGAGAAGGGTGGGAAT
CCGCACCCTGGCAGTCGGATTCACGTGTGGGCTGAGCAGGCTGGTTTCGCGACCGAATCAATCGACAAGAGCGCT
GGGGCCTGGAACAAGAGCAAGCTATGGTTAGGAATGATGCTTGCCATTCGAGTCTGGGTTTCTGAGCCAGCTAGA
ACGGAAAAGAGGCTGGATCGGTGGAAGTGA
Gene >Ophcf2|02465
ATGGAACCCGTCAAGGAGGAACACGTCTACTCGACTGATCACTCGGACTCTGTCCTACGTACTCACCGCTGGCGT
ACCCTCGCCAACTCGGCTGGCTATTTACTCCCTCATCTTCTGCCGGACATGATGGTTCTCGACGTCGGTTGCGGG
CCGGGCTCTATCACTATCGATCTGGCGAGGGCCGTCCCCGAGGGCCATGTTACGGGCGTCGAGTACGTATCCGAT
CCGCTTGACGGTGCCCGAGCAGACGCCCGGGCTCAGGCCATCACCAACGTCTCCTTCAGCGTGGCCGACGCTCAT
CATCTGCCCTTCCCGGACGCTTCTTTCCATGTCGTTCACGCCCATCAGGTACTACAGCATCTTGCCGATCCCGTC
CAGGCTTTGCGTGAGATGCGTCGCGTCGTGAGACCAGGAGGTCTCGTCGCCTGCCGCGAATCAGCCTCGATGACA
TGGCACCCCGAATCCAAAGGTATAGAAGCCTGGCTACAGCTGACGACGCGCGTGGCCCGTGAGAAGGGTGGGAAT
CCGCACCCTGGCAGTCGGATTCACGTGTGGGCTGAGCAGGCTGGTTTCGCGACCGAATCAATCGACAAGAGCGCT
GGGGCCTGGTGCTTTGCCTCGGCGGAGGAGAGGGCTTACTGGGGGGGTTCCATGGCTGAGAGGGCTGCCTCTTCG
GGCTTTGTGAAGATGGCGGTGGAGGGAGGGTTTGCGACGAGGGAGGAGCTGGGGGGATTGGGCGTGCTTGGGGGG
TGTTTGCTGAGGATCCTGAGGCTTGGTTCGGGTTGCTTCATGGTCAGATTTTATGTAGGAGGACTTAGCTAGCTG
GTGTTTGTGTCACTTTGACTTGAGGAGAGCGAAGACTTAAGTCAAGGTCTTACCAACGAGTCTCTGAATCTCATA
GTCTTGTCTCATAAAGTCTTGGAGAAAGACTGAGTGTAACATGTCGAGTTAACATGGTCATTAACACCATGCAAC
GCCCGACACAACTAATGGACATGATTGCATATCTTGTCATTGATCAACTCCAGCGCTATGAAGCGCCCCCCCTGC
TCTTAAAGTCAAGCCCAGCCTTGAAGCCGTCCACAACAGCCACCAATAGAGTCCGCCATCACCCAATCCCGGTTC
AAGACTCGACGAAGCTGCTTCCATTCCGACATGGACTGGAGGGATATCGGAATAGTCTGACCCGTCAGCCACGAC
GCGAATTGAGCCTCTCTATGGGATTAGAGTCCCTACCTTAACAAGAAGCTTCTCCAGTTTCCCTGTTAGGGCCGG
GCGCTGTCAAAACCCGATACAGCAAGTGTTATCCAGCAGGTCGGCGAACCACGGTAGCGTCGGTTCCATGTCTTC
TGCAGGCGGCGGCGGTGTCGGGGGCGGCGACGGGGGCGGCGAAGGGGCGGCGGTGGATGTGGCATCGGCATCGGC
GGCATCGGCACCGGCTCGGGTGTGCGTGGAGGTGACGGTTCGGGATCAGCCGGGGTTGATTTCCCTTGCTTCATG
TTTCTGTACCCCTTCTAGTTAGATCAGAGTGCCATGACTGGGTTATTCCGTCTCGAACTTGACTCGGCTGGAAAG
GAACAAGAGCAAGCTATGGTTAGGAATGATGCTTGCCATTCGAGTCTGGGTTTCTGAGCCAGCTAGAACGGAAAA
GAGGCTGGATCGGTGGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail