Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02463
Gene name
Locationscaffold_02:3814736..3816844
Strand-
Gene length (bp)2108
Transcript length (bp)1947
Coding sequence length (bp)1947
Protein length (aa) 649

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00319 SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain) 5.2E-22 11 57

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0046983 protein dimerization activity Yes
GO:0005515 protein binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3705 0.965 0.0201 0.0332 0.0513 0.0004 0.0257 0.0235 0.0031 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
SRF-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup712
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5399
Ophiocordyceps australis map64 (Brazil) OphauB2|1547
Ophiocordyceps camponoti-floridani Ophcf2|02463 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1366
Ophiocordyceps camponoti-rufipedis Ophun1|2764
Ophiocordyceps kimflemingae Ophio5|3931
Ophiocordyceps subramaniannii Hirsu2|1507

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02463
MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELSVLCSVDVAVFIFGNNKKLFEYSSSDMRELVQRYQMHGSI
SEHKGPADFNGGNDDDDDDDADGSPPRASDAVPMMPPQFAPGQHPPFAQILRHHAPSVSPPVAPGVPYQPHHAVQ
PHPRGATPQPPMGPRTGSSNDVRRVGPGIPPHSVSGPHPSHPASHPASHPASHPGITYIPTPPIYNPSGNQPAIV
PQPGGHYSYPPPTQQPSYVQDRRPSAPPSYPTQHPPPPPPPPPPPPPSQAAAATSVRPEPSPPLANIHKNGHPRS
LSQPAISATHVGGDRRSQDTQPHPSAEHNKVETTLQRPQPPLVNTDTAIKKMPQRKSHSIFTPIEENRSILYLHA
SSFSTEPQAVKAETGPAPPPRPSAATAPRRSPSAEIPTQSSLDKAHNPSVSSAPETAAPTPPSRANSNVGGPSAG
ASRPRGPRLTVQIPDGGSEPGSAATGESNSPNNPAMTPTQAPQRSSSHSSVVLPPPSPSASALLSAGATGPPNPF
ARPPPQQNVNGDTPASALPSRFLNEQLLPSPSSFYPEWSFRSSDNNTLPSPLNFATPVVGSGPSFLRDDGHAVGG
VSAAASSQTASHMSSGLGKRKSPDFGIGGHGEAHAVPSEPKRVKVEYA*
Coding >Ophcf2|02463
ATGGGGCGCAGAAAGATTGAGATCAAGGCCATCAAGGATGATCGGAACCGCTCAGTCACCTTTCTCAAGCGCAAA
GGAGGACTGTTCAAGAAGGCTCACGAGCTGTCCGTCTTGTGCTCCGTCGACGTGGCCGTCTTCATCTTCGGCAAC
AATAAGAAGCTCTTCGAGTACTCATCGTCGGACATGCGAGAGCTGGTTCAGCGCTACCAGATGCACGGCTCCATC
AGCGAGCACAAGGGCCCGGCCGACTTCAACGGCGGCAACGACGACGACGACGATGACGACGCAGACGGGAGCCCT
CCGCGCGCCTCCGACGCCGTCCCCATGATGCCCCCCCAGTTTGCGCCCGGTCAGCACCCTCCTTTCGCACAGATT
CTCCGCCATCACGCGCCCTCGGTCTCGCCTCCCGTCGCCCCCGGCGTCCCATATCAACCGCACCATGCCGTTCAA
CCTCACCCTCGCGGCGCCACCCCGCAGCCGCCCATGGGCCCGCGTACCGGCTCCAGCAACGACGTCCGCCGAGTG
GGGCCCGGCATTCCTCCCCACTCCGTCTCCGGCCCCCATCCATCGCATCCTGCCTCGCATCCTGCCTCGCATCCT
GCTTCTCATCCCGGCATCACTTACATACCCACACCGCCCATCTACAACCCGTCCGGGAATCAGCCAGCCATTGTT
CCTCAGCCAGGAGGTCACTACTCGTACCCGCCCCCGACCCAGCAGCCGTCTTACGTCCAAGATCGCCGTCCCTCG
GCGCCCCCGAGCTATCCCACCCAGCATCCGCCTCCGCCGCCTCCGCCGCCGCCACCACCACCGCCATCGCAGGCT
GCCGCTGCCACCTCCGTCCGCCCCGAACCGTCGCCGCCTCTAGCCAATATTCACAAAAATGGTCATCCTCGCTCT
CTGTCGCAGCCTGCCATCTCTGCAACGCACGTCGGTGGCGACCGCCGCTCGCAAGATACCCAGCCCCATCCGTCC
GCCGAGCACAACAAGGTCGAGACGACTCTGCAGCGGCCGCAGCCACCGCTGGTCAACACGGACACGGCCATAAAA
AAGATGCCTCAGCGCAAGTCTCATAGCATCTTTACTCCGATCGAGGAGAATCGATCGATCCTCTACCTACACGCC
TCGTCCTTTTCCACTGAGCCCCAGGCTGTCAAGGCCGAGACGGGCCCGGCCCCGCCGCCGCGCCCCTCCGCCGCC
ACCGCCCCGAGGCGTTCTCCGTCTGCCGAAATCCCCACGCAGAGCAGCCTTGACAAGGCGCACAACCCGTCGGTG
TCGTCGGCCCCTGAAACGGCAGCGCCTACGCCGCCTTCTCGGGCCAACAGCAACGTAGGCGGGCCTTCGGCGGGC
GCATCGCGGCCGAGGGGTCCGCGGCTGACGGTGCAGATCCCGGACGGCGGGTCGGAGCCCGGTAGTGCGGCCACC
GGAGAGTCCAACTCGCCCAACAACCCGGCCATGACGCCGACGCAGGCGCCGCAGCGGAGCAGCTCGCATTCTTCC
GTTGTCCTCCCGCCTCCCTCGCCGTCGGCATCGGCGCTGCTGTCCGCCGGAGCCACGGGTCCGCCGAATCCCTTT
GCCCGGCCGCCACCCCAGCAGAACGTCAACGGCGACACGCCCGCATCGGCGCTGCCGTCGCGCTTCCTCAACGAA
CAGCTGCTCCCCAGCCCCAGCAGCTTCTACCCGGAGTGGAGCTTTCGCAGCAGCGACAACAATACACTGCCGAGT
CCCCTGAACTTTGCCACGCCCGTCGTCGGGTCCGGGCCCAGCTTCCTGCGAGACGACGGTCACGCGGTCGGCGGC
GTCTCGGCGGCGGCGTCTAGCCAGACGGCCTCGCACATGTCGTCGGGTCTCGGGAAGCGCAAGTCGCCCGACTTT
GGCATCGGCGGCCACGGCGAAGCTCACGCCGTGCCAAGCGAACCGAAGCGGGTCAAGGTCGAATACGCGTGA
Transcript >Ophcf2|02463
ATGGGGCGCAGAAAGATTGAGATCAAGGCCATCAAGGATGATCGGAACCGCTCAGTCACCTTTCTCAAGCGCAAA
GGAGGACTGTTCAAGAAGGCTCACGAGCTGTCCGTCTTGTGCTCCGTCGACGTGGCCGTCTTCATCTTCGGCAAC
AATAAGAAGCTCTTCGAGTACTCATCGTCGGACATGCGAGAGCTGGTTCAGCGCTACCAGATGCACGGCTCCATC
AGCGAGCACAAGGGCCCGGCCGACTTCAACGGCGGCAACGACGACGACGACGATGACGACGCAGACGGGAGCCCT
CCGCGCGCCTCCGACGCCGTCCCCATGATGCCCCCCCAGTTTGCGCCCGGTCAGCACCCTCCTTTCGCACAGATT
CTCCGCCATCACGCGCCCTCGGTCTCGCCTCCCGTCGCCCCCGGCGTCCCATATCAACCGCACCATGCCGTTCAA
CCTCACCCTCGCGGCGCCACCCCGCAGCCGCCCATGGGCCCGCGTACCGGCTCCAGCAACGACGTCCGCCGAGTG
GGGCCCGGCATTCCTCCCCACTCCGTCTCCGGCCCCCATCCATCGCATCCTGCCTCGCATCCTGCCTCGCATCCT
GCTTCTCATCCCGGCATCACTTACATACCCACACCGCCCATCTACAACCCGTCCGGGAATCAGCCAGCCATTGTT
CCTCAGCCAGGAGGTCACTACTCGTACCCGCCCCCGACCCAGCAGCCGTCTTACGTCCAAGATCGCCGTCCCTCG
GCGCCCCCGAGCTATCCCACCCAGCATCCGCCTCCGCCGCCTCCGCCGCCGCCACCACCACCGCCATCGCAGGCT
GCCGCTGCCACCTCCGTCCGCCCCGAACCGTCGCCGCCTCTAGCCAATATTCACAAAAATGGTCATCCTCGCTCT
CTGTCGCAGCCTGCCATCTCTGCAACGCACGTCGGTGGCGACCGCCGCTCGCAAGATACCCAGCCCCATCCGTCC
GCCGAGCACAACAAGGTCGAGACGACTCTGCAGCGGCCGCAGCCACCGCTGGTCAACACGGACACGGCCATAAAA
AAGATGCCTCAGCGCAAGTCTCATAGCATCTTTACTCCGATCGAGGAGAATCGATCGATCCTCTACCTACACGCC
TCGTCCTTTTCCACTGAGCCCCAGGCTGTCAAGGCCGAGACGGGCCCGGCCCCGCCGCCGCGCCCCTCCGCCGCC
ACCGCCCCGAGGCGTTCTCCGTCTGCCGAAATCCCCACGCAGAGCAGCCTTGACAAGGCGCACAACCCGTCGGTG
TCGTCGGCCCCTGAAACGGCAGCGCCTACGCCGCCTTCTCGGGCCAACAGCAACGTAGGCGGGCCTTCGGCGGGC
GCATCGCGGCCGAGGGGTCCGCGGCTGACGGTGCAGATCCCGGACGGCGGGTCGGAGCCCGGTAGTGCGGCCACC
GGAGAGTCCAACTCGCCCAACAACCCGGCCATGACGCCGACGCAGGCGCCGCAGCGGAGCAGCTCGCATTCTTCC
GTTGTCCTCCCGCCTCCCTCGCCGTCGGCATCGGCGCTGCTGTCCGCCGGAGCCACGGGTCCGCCGAATCCCTTT
GCCCGGCCGCCACCCCAGCAGAACGTCAACGGCGACACGCCCGCATCGGCGCTGCCGTCGCGCTTCCTCAACGAA
CAGCTGCTCCCCAGCCCCAGCAGCTTCTACCCGGAGTGGAGCTTTCGCAGCAGCGACAACAATACACTGCCGAGT
CCCCTGAACTTTGCCACGCCCGTCGTCGGGTCCGGGCCCAGCTTCCTGCGAGACGACGGTCACGCGGTCGGCGGC
GTCTCGGCGGCGGCGTCTAGCCAGACGGCCTCGCACATGTCGTCGGGTCTCGGGAAGCGCAAGTCGCCCGACTTT
GGCATCGGCGGCCACGGCGAAGCTCACGCCGTGCCAAGCGAACCGAAGCGGGTCAAGGTCGAATACGCGTGA
Gene >Ophcf2|02463
ATGGGGCGCAGAAAGATTGAGATCAAGGCCATCAAGGATGATCGGAACCGCTCAGTGTACGTCAGATTCCTGAAA
CGCTCCGTCATCTCCTCGACTGACCCGTTCATAGCACCTTTCTCAAGCGCAAAGGAGGACTGTTCAAGAAGGCTC
ACGAGCTGTCCGTCTTGTGCTCCGTCGACGTGGCCGTCTTCATCTTCGGCAACAATAAGAAGCTCTTCGAGTACT
CATCGTCGGACATGCGAGAGCTGGTTCAGCGCTACCAGATGGTAGGTCGTTCCCATCTAGACCCCCCAACGTTTG
TCTTTGCTTACCATCCTGGTAATCTCGCAGCACGGCTCCATCAGCGAGCACAAGGGCCCGGCCGACTTCAACGGC
GGCAACGACGACGACGACGATGACGACGCAGACGGGAGCCCTCCGCGCGCCTCCGACGCCGTCCCCATGATGCCC
CCCCAGTTTGCGCCCGGTCAGCACCCTCCTTTCGCACAGATTCTCCGCCATCACGCGCCCTCGGTCTCGCCTCCC
GTCGCCCCCGGCGTCCCATATCAACCGCACCATGCCGTTCAACCTCACCCTCGCGGCGCCACCCCGCAGCCGCCC
ATGGGCCCGCGTACCGGCTCCAGCAACGACGTCCGCCGAGTGGGGCCCGGCATTCCTCCCCACTCCGTCTCCGGC
CCCCATCCATCGCATCCTGCCTCGCATCCTGCCTCGCATCCTGCTTCTCATCCCGGCATCACTTACATACCCACA
CCGCCCATCTACAACCCGTCCGGGAATCAGCCAGCCATTGTTCCTCAGCCAGGAGGTCACTACTCGTACCCGCCC
CCGACCCAGCAGCCGTCTTACGTCCAAGATCGCCGTCCCTCGGCGCCCCCGAGCTATCCCACCCAGCATCCGCCT
CCGCCGCCTCCGCCGCCGCCACCACCACCGCCATCGCAGGCTGCCGCTGCCACCTCCGTCCGCCCCGAACCGTCG
CCGCCTCTAGCCAATATTCACAAAAATGGTCATCCTCGCTCTCTGTCGCAGCCTGCCATCTCTGCAACGCACGTC
GGTGGCGACCGCCGCTCGCAAGATACCCAGCCCCATCCGTCCGCCGAGCACAACAAGGTCGAGACGACTCTGCAG
CGGCCGCAGCCACCGCTGGTCAACACGGACACGGCCATAAAAAAGATGCCTCAGCGCAAGTCTCATAGCATCTTT
ACTCCGATCGAGGAGAATCGATCGATCCTCTACCTACACGCCTCGTCCTTTTCCACTGAGCCCCAGGCTGTCAAG
GCCGAGACGGGCCCGGCCCCGCCGCCGCGCCCCTCCGCCGCCACCGCCCCGAGGCGTTCTCCGTCTGCCGAAATC
CCGTCCGGCGATGGGGGTCGACGCCGCCGCAGCTGAGACGATCCAGCACGCAGAGCAGCCTTGACAAGGCGCACA
ACCCGTCGGTGTCGTCGGCCCCTGAAACGGCAGCGCCTACGCCGCCTTCTCGGGCCAACAGCAACGTAGGCGGGC
CTTCGGCGGGCGCATCGCGGCCGAGGGGTCCGCGGCTGACGGTGCAGATCCCGGACGGCGGGTCGGAGCCCGGTA
GTGCGGCCACCGGAGAGTCCAACTCGCCCAACAACCCGGCCATGACGCCGACGCAGGCGCCGCAGCGGAGCAGCT
CGCATTCTTCCGTTGTCCTCCCGCCTCCCTCGCCGTCGGCATCGGCGCTGCTGTCCGCCGGAGCCACGGGTCCGC
CGAATCCCTTTGCCCGGCCGCCACCCCAGCAGAACGTCAACGGCGACACGCCCGCATCGGCGCTGCCGTCGCGCT
TCCTCAACGAACAGCTGCTCCCCAGCCCCAGCAGCTTCTACCCGGAGTGGAGCTTTCGCAGCAGCGACAACAATA
CACTGCCGAGTCCCCTGAACTTTGCCACGCCCGTCGTCGGGTCCGGGCCCAGCTTCCTGCGAGACGACGGTCACG
CGGTCGGCGGCGTCTCGGCGGCGGCGTCTAGCCAGACGGCCTCGCACATGTCGTCGGGTCTCGGGAAGCGCAAGT
CGCCCGACTTTGGCATCGGCGGCCACGGCGAAGCTCACGCCGTGCCAAGCGAACCGAAGCGGGTCAAGGTCGAAT
ACGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail