Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02461
Gene name
Locationscaffold_02:3810331..3812381
Strand-
Gene length (bp)2050
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00890 FAD_binding_2 FAD binding domain 9.9E-84 5 445
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.9E-20 547 618
PF01266 DAO FAD dependent oxidoreductase 1.1E-13 4 207
PF12831 FAD_oxidored FAD dependent oxidoreductase 5.6E-10 5 191
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 6.1E-07 7 50
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.3E-06 4 202

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02461
MAPRVIVVGGGLSGLSAAHTIYLAGGNVVVLDKQGFFGGNSTKATSGINGALTRTQVDHQIGDSVKQFYDDTLKS
ARDKARPDLIKVLTYKSAAAVEWLQDVFNLDLTLVSRLGGHTQPRTHRGHDAKFPGMAITYALMQRLEELAETEP
HRVEIIKKARVTDLNKDGNTVTGVTFECDGQSASLDGPVVLATGGYAADFSETSLLKKHRPDTYGLATTNGTHAT
GDGQKMVMAIGGNAIDMDKVQVHPTGLVDPKDPGSKWKFLAAEALRGEGGLLLNADGDRFCDELGHRDYVSGMMW
KEKDKNKFPIRLVLNSKASNVLDFHTRHYSGRGLMRKMTGKELAREIGCSPEHLQKTFTTYNAIAEGKQKDPWGK
RFFHNMPLDVDDDFHVALMEPVLHFTMGGIEINDKAQVLNGEKKPFDGLFACGELAGGVHGANRLGGSSLLGCVV
YGRVAGDTASNYLFQQALSGSGGSAAQRLGQISLHLDPSAPGRLTVEWSNSSSCPSSTAQLPVAGSSSTVGAPAA
GGAKASKPNDPKAFVVPEKEFTMDEVAKHNKKEDLWVVVKGVVMDLSDWLDEHPGGPQAIMNFMGRDATEEFEML
HDDEVIPKYAPRQVIGRVKGQTPSLEL*
Coding >Ophcf2|02461
ATGGCTCCCAGAGTCATTGTCGTCGGCGGTGGCCTCTCGGGCTTGAGTGCCGCTCATACCATCTACCTGGCCGGT
GGCAATGTCGTTGTCCTCGATAAGCAGGGCTTCTTCGGTGGCAACTCGACAAAGGCCACGTCCGGCATCAACGGC
GCCCTGACGCGCACGCAGGTCGACCATCAGATTGGCGATAGCGTTAAGCAGTTCTACGATGATACGTTGAAGTCG
GCGCGTGACAAGGCGCGGCCGGATCTCATCAAGGTTCTCACCTACAAGTCTGCCGCCGCCGTCGAGTGGTTGCAG
GACGTCTTCAACTTGGATTTGACGCTCGTCTCCCGTCTAGGCGGTCACACACAACCGCGAACCCATCGCGGACAC
GACGCCAAGTTTCCCGGCATGGCCATTACCTACGCTCTGATGCAGCGGCTGGAGGAGTTGGCCGAGACGGAGCCG
CACCGGGTTGAGATTATCAAGAAGGCTCGTGTCACGGATCTTAACAAGGATGGCAACACCGTCACGGGCGTCACA
TTTGAATGCGACGGCCAGTCGGCTTCGTTGGATGGTCCCGTCGTCCTCGCCACCGGTGGATACGCTGCCGACTTT
AGTGAGACGTCGCTTCTCAAGAAGCACCGGCCCGACACGTATGGTCTCGCCACTACAAACGGCACGCACGCCACG
GGCGACGGTCAGAAGATGGTCATGGCCATCGGCGGCAATGCCATAGATATGGACAAGGTGCAGGTCCACCCGACA
GGCCTCGTCGACCCCAAGGACCCGGGCTCTAAGTGGAAGTTCCTGGCGGCCGAGGCCCTCCGTGGCGAGGGTGGC
CTGCTGCTCAACGCAGACGGTGATCGCTTCTGCGACGAGCTGGGCCACCGCGACTACGTTTCCGGCATGATGTGG
AAGGAAAAGGACAAGAACAAGTTTCCCATCCGGCTGGTGCTCAACTCCAAGGCATCCAACGTGCTCGACTTTCAC
ACCCGCCACTACTCGGGCCGCGGCCTGATGCGCAAGATGACGGGCAAGGAGCTGGCGCGCGAGATTGGCTGCTCG
CCCGAGCATCTGCAGAAGACGTTTACCACGTACAACGCCATCGCCGAGGGGAAGCAAAAGGATCCCTGGGGCAAG
CGCTTCTTCCACAACATGCCGCTCGATGTCGATGACGATTTCCACGTGGCTCTGATGGAGCCCGTCCTGCACTTT
ACCATGGGTGGCATCGAGATCAACGACAAGGCGCAGGTTCTTAATGGCGAGAAGAAGCCTTTTGACGGACTCTTT
GCCTGCGGCGAGCTGGCCGGTGGCGTTCACGGCGCCAACCGACTGGGCGGCTCTAGTCTGCTGGGCTGCGTCGTC
TATGGCCGCGTGGCTGGCGACACGGCCAGCAACTACCTGTTCCAGCAGGCCCTGTCCGGGAGCGGCGGGTCGGCC
GCCCAGCGTCTGGGGCAGATCTCGCTGCACCTGGACCCTTCGGCTCCGGGGCGGCTGACGGTCGAGTGGTCCAAC
TCGTCCTCGTGCCCGTCGTCGACGGCGCAGCTGCCGGTGGCGGGCAGCTCGTCGACGGTCGGGGCCCCGGCCGCG
GGAGGTGCCAAGGCGTCCAAGCCCAACGACCCCAAGGCTTTTGTGGTGCCGGAGAAGGAGTTTACCATGGACGAG
GTGGCCAAGCACAACAAGAAGGAAGACCTCTGGGTCGTGGTCAAGGGCGTCGTCATGGACCTCAGCGACTGGCTG
GACGAGCATCCGGGCGGACCGCAGGCCATTATGAACTTCATGGGCCGCGACGCGACTGAGGAGTTTGAGATGCTT
CACGACGACGAGGTGATTCCCAAGTACGCGCCGCGGCAGGTGATTGGGCGCGTTAAGGGGCAGACGCCCAGCCTG
GAGCTGTGA
Transcript >Ophcf2|02461
ATGGCTCCCAGAGTCATTGTCGTCGGCGGTGGCCTCTCGGGCTTGAGTGCCGCTCATACCATCTACCTGGCCGGT
GGCAATGTCGTTGTCCTCGATAAGCAGGGCTTCTTCGGTGGCAACTCGACAAAGGCCACGTCCGGCATCAACGGC
GCCCTGACGCGCACGCAGGTCGACCATCAGATTGGCGATAGCGTTAAGCAGTTCTACGATGATACGTTGAAGTCG
GCGCGTGACAAGGCGCGGCCGGATCTCATCAAGGTTCTCACCTACAAGTCTGCCGCCGCCGTCGAGTGGTTGCAG
GACGTCTTCAACTTGGATTTGACGCTCGTCTCCCGTCTAGGCGGTCACACACAACCGCGAACCCATCGCGGACAC
GACGCCAAGTTTCCCGGCATGGCCATTACCTACGCTCTGATGCAGCGGCTGGAGGAGTTGGCCGAGACGGAGCCG
CACCGGGTTGAGATTATCAAGAAGGCTCGTGTCACGGATCTTAACAAGGATGGCAACACCGTCACGGGCGTCACA
TTTGAATGCGACGGCCAGTCGGCTTCGTTGGATGGTCCCGTCGTCCTCGCCACCGGTGGATACGCTGCCGACTTT
AGTGAGACGTCGCTTCTCAAGAAGCACCGGCCCGACACGTATGGTCTCGCCACTACAAACGGCACGCACGCCACG
GGCGACGGTCAGAAGATGGTCATGGCCATCGGCGGCAATGCCATAGATATGGACAAGGTGCAGGTCCACCCGACA
GGCCTCGTCGACCCCAAGGACCCGGGCTCTAAGTGGAAGTTCCTGGCGGCCGAGGCCCTCCGTGGCGAGGGTGGC
CTGCTGCTCAACGCAGACGGTGATCGCTTCTGCGACGAGCTGGGCCACCGCGACTACGTTTCCGGCATGATGTGG
AAGGAAAAGGACAAGAACAAGTTTCCCATCCGGCTGGTGCTCAACTCCAAGGCATCCAACGTGCTCGACTTTCAC
ACCCGCCACTACTCGGGCCGCGGCCTGATGCGCAAGATGACGGGCAAGGAGCTGGCGCGCGAGATTGGCTGCTCG
CCCGAGCATCTGCAGAAGACGTTTACCACGTACAACGCCATCGCCGAGGGGAAGCAAAAGGATCCCTGGGGCAAG
CGCTTCTTCCACAACATGCCGCTCGATGTCGATGACGATTTCCACGTGGCTCTGATGGAGCCCGTCCTGCACTTT
ACCATGGGTGGCATCGAGATCAACGACAAGGCGCAGGTTCTTAATGGCGAGAAGAAGCCTTTTGACGGACTCTTT
GCCTGCGGCGAGCTGGCCGGTGGCGTTCACGGCGCCAACCGACTGGGCGGCTCTAGTCTGCTGGGCTGCGTCGTC
TATGGCCGCGTGGCTGGCGACACGGCCAGCAACTACCTGTTCCAGCAGGCCCTGTCCGGGAGCGGCGGGTCGGCC
GCCCAGCGTCTGGGGCAGATCTCGCTGCACCTGGACCCTTCGGCTCCGGGGCGGCTGACGGTCGAGTGGTCCAAC
TCGTCCTCGTGCCCGTCGTCGACGGCGCAGCTGCCGGTGGCGGGCAGCTCGTCGACGGTCGGGGCCCCGGCCGCG
GGAGGTGCCAAGGCGTCCAAGCCCAACGACCCCAAGGCTTTTGTGGTGCCGGAGAAGGAGTTTACCATGGACGAG
GTGGCCAAGCACAACAAGAAGGAAGACCTCTGGGTCGTGGTCAAGGGCGTCGTCATGGACCTCAGCGACTGGCTG
GACGAGCATCCGGGCGGACCGCAGGCCATTATGAACTTCATGGGCCGCGACGCGACTGAGGAGTTTGAGATGCTT
CACGACGACGAGGTGATTCCCAAGTACGCGCCGCGGCAGGTGATTGGGCGCGTTAAGGGGCAGACGCCCAGCCTG
GAGCTGTGA
Gene >Ophcf2|02461
ATGGCTCCCAGAGTCATTGTCGTCGGCGGTGGCCGTATGTCGAATATCCCGCGTTTCGCTGGACCATTTACTGAC
GGGCCTATCCTGCAGTCTCGGGCTTGAGTGCCGCTCATACCATCTACCTGGCCGGTGGCAATGTCGTTGTCCTCG
ATAAGCAGGGTGTGTTTTGACCGTCGGATGGATTGAAGGTCGCTCATGCTGACACGACACTATGCAGGCTTCTTC
GGTGGCAACTCGACAAAGGCCACGTCCGGCATCAACGGCGCCCTGACGCGCACGCAGGTCGACCATCAGATTGGC
GATAGCGTTAAGCAGTTCTACGATGATACGTTGAAGTCGGCGCGTGACAAGGCGCGGCCGGATCTCATCAAGGTT
CTCACCTACAAGTCTGCCGCCGCCGTCGAGTGGTTGCAGGACGTCTTCAACTTGGATTTGACGCTCGTCTCCCGT
CTAGGGTGAGTCTTGAGATACCTTTGGGTTGCTGTTTACGATGCTGACTCTCCGAAGCGGTCACACACAACCGCG
AACCCATCGCGGACACGACGCCAAGTTTCCCGGCATGGCCATTACCTACGCTCTGATGCAGCGGCTGGAGGAGTT
GGCCGAGACGGAGCCGCACCGGGTTGAGATTATCAAGAAGGCTCGTGTCACGGATCTTAACAAGGATGGCAACAC
CGTCACGGGCGTCACATTTGAATGCGACGGCCAGTCGGCTTCGTTGGATGGTCCCGTCGTCCTCGCCACCGGTGG
ATACGCTGCCGACTTTAGTGAGACGTCGCTTCTCAAGAAGCACCGGCCCGACACGTATGGTCTCGCCACTACAAA
CGGCACGCACGCCACGGGCGACGGTCAGAAGATGGTCATGGCCATCGGCGGCAATGCCATAGATATGGACAAGGT
GCAGGTCCACCCGACAGGCCTCGTCGACCCCAAGGACCCGGGCTCTAAGTGGAAGTTCCTGGCGGCCGAGGCCCT
CCGTGGCGAGGGTGGCCTGCTGCTCAACGCAGACGGTGATCGCTTCTGCGACGAGCTGGGCCACCGCGACTACGT
TTCCGGCATGATGTGGAAGGAAAAGGACAAGAACAAGTTTCCCATCCGGCTGGTGCTCAACTCCAAGGCATCCAA
CGTGCTCGACTTTCACACCCGCCACTACTCGGGCCGCGGCCTGATGCGCAAGATGACGGGCAAGGAGCTGGCGCG
CGAGATTGGCTGCTCGCCCGAGCATCTGCAGAAGACGTTTACCACGTACAACGCCATCGCCGAGGGGAAGCAAAA
GGATCCCTGGGGCAAGCGCTTCTTCCACAACATGCCGCTCGATGTCGATGACGATTTCCACGTGGCTCTGATGGA
GCCCGTCCTGCACTTTACCATGGGTGGCATCGAGATCAACGACAAGGCGCAGGTTCTTAATGGCGAGAAGAAGCC
TTTTGACGGACTCTTTGCCTGCGGCGAGCTGGCCGGTGGCGTTCACGGCGCCAACCGACTGGGCGGCTCTAGTCT
GCTGGGCTGCGTCGTCTATGGCCGCGTGGCTGGCGACACGGCCAGCAACTACCTGTTCCAGCAGGCCCTGTCCGG
GAGCGGCGGGTCGGCCGCCCAGCGTCTGGGGCAGATCTCGCTGCACCTGGACCCTTCGGCTCCGGGGCGGCTGAC
GGTCGAGTGGTCCAACTCGTCCTCGTGCCCGTCGTCGACGGCGCAGCTGCCGGTGGCGGGCAGCTCGTCGACGGT
CGGGGCCCCGGCCGCGGGAGGTGCCAAGGCGTCCAAGCCCAACGACCCCAAGGCTTTTGTGGTGCCGGAGAAGGA
GTTTACCATGGACGAGGTGGCCAAGCACAACAAGAAGGAAGACCTCTGGGTCGTGGTCAAGGGCGTCGTCATGGA
CCTCAGCGACTGGCTGGACGAGCATCCGGGCGGACCGCAGGCCATTATGAACTTCATGGGCCGCGACGCGACTGA
GGAGTTTGAGATGCTTCACGACGACGAGGTGATTCCCAAGTACGCGCCGCGGCAGGTGATTGGGCGCGTTAAGGG
GCAGACGCCCAGCCTGGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail