Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02459
Gene name
Locationscaffold_02:3801455..3805379
Strand+
Gene length (bp)3924
Transcript length (bp)3432
Coding sequence length (bp)3432
Protein length (aa) 1144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12157 DUF3591 Protein of unknown function (DUF3591) 1.3E-174 413 929

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.176 0.8747 0.1544 0.0315 0.0359 0.003 0.0414 0.0188 0.0339 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 53.00 29.11 76.88
Alive In ants, during behavior modification 60.88 32.13 89.64
Dead In ants, recently dead 56.35 30.90 81.80

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.535721 no
Alive Dead 0.709256 no
Dead Fungus 0.802663 no

Orthologs

Orthofinder run ID4
Orthogroup4351
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3921
Ophiocordyceps australis map64 (Brazil) OphauB2|6301
Ophiocordyceps camponoti-floridani Ophcf2|02459 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3747
Ophiocordyceps kimflemingae Ophio5|4699
Ophiocordyceps subramaniannii Hirsu2|8945

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02459
MAEAEFSSLDENAWKAQDAADEREIARLLEQSQEGANGGLTLDDTPFDQTNKADDAQDFEDISDDDLPDEERPSA
GNTLELPGLTDDGGTSNDADDLFGEGPSSPADAVLGPATPAPQVRDDADTQAADPGLSFASINFDPDPHLHGAAN
QDPDIPSAAETVEDLLKAAWPAFRKGHILTWSELLPPKKAIWKEKKPSKKPKRLVTSKLTLEMAPDQEKQFRIPG
SAKARPSNSVQGGLVYCGLPDEDEDRDAVKIDADVDSDSETVNGFTLRDIEMVCEDWGARIDDAEAQFLSSQASE
KELARKRRVEDDEQDDEWDAEFLLDAAEDAQPRLKKRRAVKPGLPEIPRWTAPSFDNFEEATRLGAKRVHLDLSD
PHLLIETEPHQPAKRSRVDGQSKRTPLGRTGRDLSQRFNLSNDGSYELLKENHQSKVRATLGNISVEHSMPAIKL
TWPYYKVKLTGTTDEYHRPRFRYKKFAGHVIKFEKPLHHKRKNMRGKAHEVFVRSKDLCLCDNSAAVLFEYCEPR
PRVLSNFGMGNKLINYYRRKDHKDEEQPPKLDLGEHRMLLPEDRSPFSLFGTVDVGETVPTLHNEMFRAPVFRHT
PRGTDFLVVRSTTGVEGSRWFMHKIDHLFVAGQTFPSVEVPGPHSRKVTNASKSRMKMLAFRLIRHSTADNCQLS
DVTKHIADSTDTQNRQKLKEFLQYDRDSGEKGMWRLKAGEVLPDENAIRAMIKPEDVSLLDAMQLGIKELEDAGY
DPRNANIDDEQVADGDGGAGGGAGGGPGRSRSRSRSRTAAAAAAGGGGGADDDEVMDDDVSKLTKNAAKKAAEKQ
EETLADKMAPWKTTKAFIDACAQKAMLQLHGEGDPTGHGLGFSFIRTSMKGGYIEAVQGPLATSADAMEREKRAN
GGHAYNVKRQQAMYEEGIREIWEKQRTTLSDRQEHDDRDVAMTEDEDDRFNVTTPAAAFDEGVSQISGLTSSSRH
PKRAIRITREVQTVDGSTQTRTEVVHDPVVISQYMKRRTEADLELRDIYSSRPTGNADHDRLANLRIKKELERLE
KNKARRQAREQQKELHQKANVGDVASPAPNGTDKMSTGTTRKCANCGLVGHIKTNKKLCPLLNGTMKADKGTAEH
GGFGNYNARTGGAGSPGP*
Coding >Ophcf2|02459
ATGGCCGAGGCCGAGTTCTCGTCGCTCGACGAAAACGCCTGGAAAGCCCAGGACGCAGCCGACGAGCGCGAAATC
GCCCGCCTACTCGAACAGAGCCAAGAGGGCGCGAATGGCGGCCTCACGCTAGACGACACGCCCTTCGATCAGACC
AACAAGGCCGACGACGCTCAAGACTTTGAGGATATCAGCGACGACGATTTACCGGACGAGGAGCGCCCCAGCGCC
GGCAACACGCTCGAGCTGCCCGGTCTCACCGACGACGGCGGCACCAGCAACGATGCCGACGACCTGTTTGGAGAG
GGCCCGTCGTCGCCTGCTGATGCCGTGCTCGGCCCTGCTACGCCCGCGCCGCAGGTTCGCGACGATGCCGACACG
CAGGCCGCCGACCCGGGGCTCAGCTTCGCCAGCATCAACTTCGACCCCGACCCTCATCTCCACGGCGCTGCCAAT
CAGGACCCGGACATTCCCTCGGCTGCGGAGACGGTCGAGGACTTGCTCAAGGCGGCCTGGCCGGCCTTTAGAAAG
GGCCACATCCTCACCTGGAGCGAGTTGCTGCCGCCCAAGAAGGCCATCTGGAAAGAGAAGAAGCCGTCAAAGAAG
CCTAAGCGACTCGTCACTAGCAAGCTGACTCTGGAAATGGCTCCCGATCAGGAAAAGCAGTTCCGCATCCCCGGC
AGTGCCAAGGCCCGACCTAGCAATTCTGTTCAGGGCGGGCTCGTCTACTGCGGCCTTCCCGATGAGGATGAGGAC
CGGGATGCCGTCAAGATTGACGCCGACGTCGACTCGGATTCAGAGACGGTCAACGGCTTTACGCTGCGCGACATT
GAGATGGTATGCGAGGACTGGGGCGCCCGTATCGATGACGCCGAGGCGCAATTCCTCTCCAGCCAGGCTTCCGAG
AAGGAGCTGGCGCGAAAGCGAAGGGTTGAAGACGACGAGCAGGACGATGAGTGGGACGCCGAATTCCTGCTCGAC
GCCGCCGAAGATGCGCAGCCCCGACTCAAGAAGCGACGCGCCGTTAAGCCCGGCCTACCGGAAATCCCCCGATGG
ACGGCGCCCTCGTTCGATAACTTTGAGGAGGCGACGCGGCTCGGTGCAAAGCGCGTCCACCTCGATCTGTCGGAT
CCCCATCTCCTGATCGAGACGGAGCCGCATCAACCGGCTAAGCGGTCGCGCGTCGACGGCCAGTCCAAGCGCACG
CCCCTCGGAAGGACGGGTCGCGACCTCTCGCAGCGGTTCAACCTCTCCAACGACGGATCTTACGAGCTTCTTAAA
GAGAACCACCAGAGCAAAGTGCGGGCGACACTCGGCAACATCTCAGTGGAGCACAGCATGCCGGCCATCAAGCTC
ACCTGGCCCTACTACAAGGTCAAGCTGACGGGCACGACGGACGAGTATCACCGGCCGCGGTTCCGCTATAAGAAG
TTCGCCGGCCACGTCATCAAGTTCGAGAAGCCGCTGCACCACAAGCGCAAGAACATGAGGGGCAAGGCTCACGAG
GTCTTTGTCCGCTCCAAGGACCTGTGCCTGTGCGACAACTCGGCGGCCGTGCTCTTCGAGTACTGCGAGCCCCGG
CCGAGGGTGCTGAGCAACTTTGGCATGGGCAACAAGCTCATCAACTACTACCGCCGAAAGGACCACAAGGACGAG
GAGCAGCCGCCCAAGCTGGACCTGGGCGAGCACCGCATGCTGCTCCCCGAGGATCGCTCTCCCTTTTCGCTCTTT
GGCACCGTTGACGTGGGCGAGACGGTTCCGACGCTGCACAACGAGATGTTCCGGGCGCCCGTCTTCCGGCACACG
CCCAGGGGCACCGACTTTCTCGTCGTCCGCAGCACGACGGGCGTCGAGGGCTCCCGCTGGTTCATGCACAAGATC
GACCACCTCTTTGTCGCCGGACAGACGTTTCCCTCGGTCGAGGTGCCGGGGCCTCATAGTAGAAAGGTGACGAAC
GCGTCCAAGAGCCGGATGAAGATGCTCGCCTTTCGCCTGATCCGCCACAGCACCGCCGACAACTGCCAGCTCTCG
GACGTAACCAAGCACATCGCCGACTCGACGGACACGCAGAACCGGCAGAAGCTCAAGGAATTCCTTCAGTACGAC
CGCGACAGTGGCGAAAAGGGCATGTGGCGACTGAAGGCCGGAGAGGTCCTGCCGGATGAGAACGCGATCCGGGCC
ATGATCAAGCCCGAGGACGTCAGTCTGCTGGACGCGATGCAGCTGGGCATCAAGGAGCTCGAGGACGCCGGCTAC
GACCCGCGCAACGCCAACATCGACGACGAGCAAGTGGCCGATGGCGACGGAGGAGCCGGGGGAGGAGCCGGAGGG
GGGCCGGGGAGGAGCCGGAGCCGGAGCCGGAGCCGGACAGCAGCAGCAGCAGCAGCAGGCGGCGGCGGCGGCGCA
GACGACGATGAGGTGATGGACGACGACGTCAGTAAGTTGACCAAGAACGCGGCCAAGAAGGCGGCGGAGAAGCAA
GAGGAGACGCTGGCGGACAAGATGGCCCCTTGGAAGACGACCAAGGCCTTCATCGACGCCTGCGCTCAGAAGGCC
ATGCTCCAGCTGCACGGCGAGGGCGACCCGACGGGCCACGGTCTCGGCTTCAGCTTCATCCGGACCTCCATGAAG
GGCGGCTACATCGAGGCAGTGCAGGGTCCGCTGGCAACGTCTGCCGATGCCATGGAACGTGAGAAGCGCGCTAAT
GGCGGGCACGCGTACAATGTCAAGCGGCAGCAGGCCATGTATGAGGAGGGCATCCGCGAGATCTGGGAGAAGCAG
AGGACGACTCTCTCGGACCGACAGGAGCACGACGACCGGGACGTGGCCATGACGGAGGACGAGGACGACCGTTTC
AACGTGACGACACCGGCGGCCGCCTTTGACGAGGGCGTCAGCCAGATCAGCGGCCTGACGTCTTCGAGCCGGCAC
CCGAAGCGGGCGATTCGCATCACGCGCGAGGTGCAGACGGTCGACGGTTCGACGCAGACGCGGACCGAGGTGGTT
CACGACCCCGTCGTCATCTCGCAGTACATGAAGCGGAGGACCGAGGCGGACCTGGAGCTCCGAGATATCTACAGC
TCCCGTCCAACGGGCAATGCCGACCATGACCGTCTTGCCAATCTTCGGATCAAGAAGGAACTCGAGCGACTGGAG
AAGAACAAGGCCCGGAGACAGGCCCGAGAGCAGCAAAAGGAACTCCACCAAAAGGCAAACGTCGGCGACGTCGCA
TCTCCCGCACCTAACGGAACCGACAAGATGTCGACTGGAACGACTCGAAAGTGTGCGAACTGTGGACTGGTCGGA
CACATCAAGACCAACAAAAAGTTATGTCCTCTGCTTAACGGGACGATGAAGGCGGACAAGGGCACGGCGGAACAC
GGCGGGTTTGGCAACTACAACGCTCGAACGGGAGGGGCGGGCTCTCCAGGGCCGTGA
Transcript >Ophcf2|02459
ATGGCCGAGGCCGAGTTCTCGTCGCTCGACGAAAACGCCTGGAAAGCCCAGGACGCAGCCGACGAGCGCGAAATC
GCCCGCCTACTCGAACAGAGCCAAGAGGGCGCGAATGGCGGCCTCACGCTAGACGACACGCCCTTCGATCAGACC
AACAAGGCCGACGACGCTCAAGACTTTGAGGATATCAGCGACGACGATTTACCGGACGAGGAGCGCCCCAGCGCC
GGCAACACGCTCGAGCTGCCCGGTCTCACCGACGACGGCGGCACCAGCAACGATGCCGACGACCTGTTTGGAGAG
GGCCCGTCGTCGCCTGCTGATGCCGTGCTCGGCCCTGCTACGCCCGCGCCGCAGGTTCGCGACGATGCCGACACG
CAGGCCGCCGACCCGGGGCTCAGCTTCGCCAGCATCAACTTCGACCCCGACCCTCATCTCCACGGCGCTGCCAAT
CAGGACCCGGACATTCCCTCGGCTGCGGAGACGGTCGAGGACTTGCTCAAGGCGGCCTGGCCGGCCTTTAGAAAG
GGCCACATCCTCACCTGGAGCGAGTTGCTGCCGCCCAAGAAGGCCATCTGGAAAGAGAAGAAGCCGTCAAAGAAG
CCTAAGCGACTCGTCACTAGCAAGCTGACTCTGGAAATGGCTCCCGATCAGGAAAAGCAGTTCCGCATCCCCGGC
AGTGCCAAGGCCCGACCTAGCAATTCTGTTCAGGGCGGGCTCGTCTACTGCGGCCTTCCCGATGAGGATGAGGAC
CGGGATGCCGTCAAGATTGACGCCGACGTCGACTCGGATTCAGAGACGGTCAACGGCTTTACGCTGCGCGACATT
GAGATGGTATGCGAGGACTGGGGCGCCCGTATCGATGACGCCGAGGCGCAATTCCTCTCCAGCCAGGCTTCCGAG
AAGGAGCTGGCGCGAAAGCGAAGGGTTGAAGACGACGAGCAGGACGATGAGTGGGACGCCGAATTCCTGCTCGAC
GCCGCCGAAGATGCGCAGCCCCGACTCAAGAAGCGACGCGCCGTTAAGCCCGGCCTACCGGAAATCCCCCGATGG
ACGGCGCCCTCGTTCGATAACTTTGAGGAGGCGACGCGGCTCGGTGCAAAGCGCGTCCACCTCGATCTGTCGGAT
CCCCATCTCCTGATCGAGACGGAGCCGCATCAACCGGCTAAGCGGTCGCGCGTCGACGGCCAGTCCAAGCGCACG
CCCCTCGGAAGGACGGGTCGCGACCTCTCGCAGCGGTTCAACCTCTCCAACGACGGATCTTACGAGCTTCTTAAA
GAGAACCACCAGAGCAAAGTGCGGGCGACACTCGGCAACATCTCAGTGGAGCACAGCATGCCGGCCATCAAGCTC
ACCTGGCCCTACTACAAGGTCAAGCTGACGGGCACGACGGACGAGTATCACCGGCCGCGGTTCCGCTATAAGAAG
TTCGCCGGCCACGTCATCAAGTTCGAGAAGCCGCTGCACCACAAGCGCAAGAACATGAGGGGCAAGGCTCACGAG
GTCTTTGTCCGCTCCAAGGACCTGTGCCTGTGCGACAACTCGGCGGCCGTGCTCTTCGAGTACTGCGAGCCCCGG
CCGAGGGTGCTGAGCAACTTTGGCATGGGCAACAAGCTCATCAACTACTACCGCCGAAAGGACCACAAGGACGAG
GAGCAGCCGCCCAAGCTGGACCTGGGCGAGCACCGCATGCTGCTCCCCGAGGATCGCTCTCCCTTTTCGCTCTTT
GGCACCGTTGACGTGGGCGAGACGGTTCCGACGCTGCACAACGAGATGTTCCGGGCGCCCGTCTTCCGGCACACG
CCCAGGGGCACCGACTTTCTCGTCGTCCGCAGCACGACGGGCGTCGAGGGCTCCCGCTGGTTCATGCACAAGATC
GACCACCTCTTTGTCGCCGGACAGACGTTTCCCTCGGTCGAGGTGCCGGGGCCTCATAGTAGAAAGGTGACGAAC
GCGTCCAAGAGCCGGATGAAGATGCTCGCCTTTCGCCTGATCCGCCACAGCACCGCCGACAACTGCCAGCTCTCG
GACGTAACCAAGCACATCGCCGACTCGACGGACACGCAGAACCGGCAGAAGCTCAAGGAATTCCTTCAGTACGAC
CGCGACAGTGGCGAAAAGGGCATGTGGCGACTGAAGGCCGGAGAGGTCCTGCCGGATGAGAACGCGATCCGGGCC
ATGATCAAGCCCGAGGACGTCAGTCTGCTGGACGCGATGCAGCTGGGCATCAAGGAGCTCGAGGACGCCGGCTAC
GACCCGCGCAACGCCAACATCGACGACGAGCAAGTGGCCGATGGCGACGGAGGAGCCGGGGGAGGAGCCGGAGGG
GGGCCGGGGAGGAGCCGGAGCCGGAGCCGGAGCCGGACAGCAGCAGCAGCAGCAGCAGGCGGCGGCGGCGGCGCA
GACGACGATGAGGTGATGGACGACGACGTCAGTAAGTTGACCAAGAACGCGGCCAAGAAGGCGGCGGAGAAGCAA
GAGGAGACGCTGGCGGACAAGATGGCCCCTTGGAAGACGACCAAGGCCTTCATCGACGCCTGCGCTCAGAAGGCC
ATGCTCCAGCTGCACGGCGAGGGCGACCCGACGGGCCACGGTCTCGGCTTCAGCTTCATCCGGACCTCCATGAAG
GGCGGCTACATCGAGGCAGTGCAGGGTCCGCTGGCAACGTCTGCCGATGCCATGGAACGTGAGAAGCGCGCTAAT
GGCGGGCACGCGTACAATGTCAAGCGGCAGCAGGCCATGTATGAGGAGGGCATCCGCGAGATCTGGGAGAAGCAG
AGGACGACTCTCTCGGACCGACAGGAGCACGACGACCGGGACGTGGCCATGACGGAGGACGAGGACGACCGTTTC
AACGTGACGACACCGGCGGCCGCCTTTGACGAGGGCGTCAGCCAGATCAGCGGCCTGACGTCTTCGAGCCGGCAC
CCGAAGCGGGCGATTCGCATCACGCGCGAGGTGCAGACGGTCGACGGTTCGACGCAGACGCGGACCGAGGTGGTT
CACGACCCCGTCGTCATCTCGCAGTACATGAAGCGGAGGACCGAGGCGGACCTGGAGCTCCGAGATATCTACAGC
TCCCGTCCAACGGGCAATGCCGACCATGACCGTCTTGCCAATCTTCGGATCAAGAAGGAACTCGAGCGACTGGAG
AAGAACAAGGCCCGGAGACAGGCCCGAGAGCAGCAAAAGGAACTCCACCAAAAGGCAAACGTCGGCGACGTCGCA
TCTCCCGCACCTAACGGAACCGACAAGATGTCGACTGGAACGACTCGAAAGTGTGCGAACTGTGGACTGGTCGGA
CACATCAAGACCAACAAAAAGTTATGTCCTCTGCTTAACGGGACGATGAAGGCGGACAAGGGCACGGCGGAACAC
GGCGGGTTTGGCAACTACAACGCTCGAACGGGAGGGGCGGGCTCTCCAGGGCCGTGA
Gene >Ophcf2|02459
ATGGCCGAGGCCGAGTTCTCGTCGCTCGACGAAAACGCCTGGAAAGCCCAGGACGCAGCCGACGAGCGCGAAATC
GCCCGCCTACTCGAACAGAGCCAAGAGGGCGCGAATGGCGGCCTCACGCTAGACGACACGCCCTTCGATCAGACC
AACAAGGCCGACGACGCTCAAGACTTTGAGGATATCAGCGACGACGATTTACCGGACGAGGAGCGCCCCAGCGCC
GGCAACACGCTCGAGCTGCCCGGTCTCACCGACGACGGCGGCACCAGCAACGATGCCGACGACCTGTTTGGAGAG
GGCCCGTCGTCGCCTGCTGATGCCGTGCTCGGCCCTGCTACGCCCGCGCCGCAGGTTCGCGACGATGCCGACACG
CAGGCCGCCGACCCGGGGCTCAGCTTCGCCAGCATCAACTTCGACCCCGACCCTCATCTCCACGGCGCTGCCAAT
CAGGACCCGGACATTCCCTCGGCTGCGGAGACGGTCGAGGACTTGCTCAAGGCGGCCTGGCCGGCCTTTAGAAAG
GGCCACATCCTCACCTGGAGCGAGTTGCTGCCGCCCAAGAAGGCCATCTGGAAAGAGAAGAAGCCGTCAAAGAAG
CCTAAGCGACTCGTCACTAGCAAGCTGACTCTGGAAATGGCTCCCGATCAGGAAAAGCAGTTCCGCATCCCCGGC
AGTGCCAAGGCCCGACCTAGCAATTCTGTTCAGGGCGGGCTCGTCTACTGCGGCCTTCCCGATGAGGATGAGGAC
CGGGATGCCGTCAAGATTGACGCCGACGTCGACTCGGATTCAGAGACGGTCAACGGCTTTACGCTGCGCGACATT
GAGATGGTATGCGAGGACTGGGGCGCCCGTATCGATGACGCCGAGGCGCAATTCCTCTCCAGCCAGGCTTCCGAG
AAGGAGCTGGCGCGAAAGCGAAGGGTTGAAGACGACGAGCAGGACGATGAGTGGGACGCCGAATTCCTGCTCGAC
GCCGCCGAAGATGCGCAGCCCCGACTCAAGAAGCGACGCGCCGTTAAGCCCGGCCTACCGGAAATCCCCCGATGG
ACGGCGCCCTCGTTCGATAACTTTGAGGAGGCGACGCGGCTCGGTGCAAAGCGCGTCCACCTCGATCTGTCGGAT
CCCCATCTCCTGATCGAGACGGAGCCGCATCAACCGGCTAAGCGGTCGCGCGTCGACGGCCAGTCCAAGCGCACG
CCCCTCGGAAGGACGGGTCGCGACCTCTCGCAGCGGTTCAACCTCTCCAACGACGGATCTTACGAGCTTCTTAAA
GAGAACCACCAGAGCAAAGTGCGGGCGACACTCGGCAACATCTCAGTGGAGCACAGCATGCCGGCCATCAAGCTC
ACCTGGCCCTACTACAAGGTCAAGCTGACGGGCACGACGGACGAGTATCACCGGCCGCGGTTCCGCTATAAGAAG
TTCGCCGGCCACGTCATCAAGTTCGAGAAGCCGCTGCACCACAAGCGCAAGAACATGAGGGGCAAGGCTCACGAG
GTCTTTGTCCGCTCCAAGGACCTGTGCCTGTGCGACAACTCGGCGGCCGTGCTCTTCGAGTACTGCGAGCCCCGG
CCGAGGGTGCTGAGCAACTTTGGCATGGGCAACAAGCTCATCAACTACTACCGCCGAAAGGACCACAAGGACGAG
GAGCAGCCGCCCAAGCTGGACCTGGGCGAGCACCGCATGCTGCTCCCCGAGGATCGCTCTCCCTTTTCGCTCTTT
GGCACCGTTGACGTGGGCGAGACGGTTCCGACGCTGCACAACGAGATGTTCCGGGCGCCCGTCTTCCGGCACACG
CCCAGGGGCACCGACTTTCTCGTCGTCCGCAGCACGACGGGCGTCGAGGGCTCCCGCTGGTTCATGCACAAGATC
GACCACCTCTTTGTCGCCGGACAGACGTTTCCCTCGGTCGAGGTGCCGGGGCCTCATAGTAGAAAGGTGACGAAC
GCGTCCAAGAGCCGGATGAAGATGCTCGCCTTTCGCCTGATCCGCCACAGCACCGCCGACAACTGCCAGCTCTCG
GACGTAACCAAGCACATCGCCGACTCGACGGACACGCAGAACCGGCAGAAGCTCAAGGAATTCCTTCAGTACGAC
CGCGACAGTGGCGAAAAGGGCATGTGGCGACTGAAGGCCGGAGAGGTCCTGCCGGATGAGAACGCGATCCGGGCC
ATGATCAAGCCCGAGGACGTCAGTCTGCTGGACGCGATGCAGCTGGGCATCAAGGAGCTCGAGGACGCCGGCTAC
GACCCGCGCAACGCCAACATCGACGACGAGCAAGTGGCCGATGGCGACGGAGGAGCCGGGGGAGGAGCCGGAGGG
GGGCCGGGGAGGAGCCGGAGCCGGAGCCGGAGCCGGAGTAGGAGCAGGAGGAGCCGGAGCAGGAGCAGCAGCAGC
AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCGGCGGCGGCGGCGCAGACGACGATGAGGTGATGGACGA
CGACGTCAGTAAGTTGACCAAGAACGCGGCCAAGAAGGCGGCGGAGAAGCAAGAGGAGACGCTGGCGGACAAGAT
GGCCCCTTGGAAGACGACCAAGGCCTTCATCGACGCCTGCGCTCAGAAGGCCATGCTCCAGCTGCACGGCGAGGG
CGACCCGACGGGCCACGGTCTCGGCTTCAGCTTCATCCGGACCTCCATGAAGGGCGGCTACATCGAGGCAGTGCA
GGGTCCGCTGGCAACGTCTGCCGATGCCATGGAACGTGAGAAGCGCGCTAATGGCGGGCACGCGTACAATGTCAA
GCGGCAGCAGGCCATGTATGAGGAGGGCATCCGCGAGATCTGGGAGAAGCAGAGGACGACTCTCTCGGACCGACA
GGAGCACGACGACCGGGACGTGGCCATGACGGAGGACGAGGACGACCGTTTCAACGTGACGACACCGGCGGCCGC
CTTTGACGAGGGCGTCAGCCAGATCAGCGGCCTGACGTCTTCGAGCCGGCACCCGAAGCGGGCGATTCGCATCAC
GCGCGAGGTGCAGACGGTCGACGGTTCGACGCAGACGCGGACCGAGGTGGTTCACGACCCCGTCGTCATCTCGCA
GTACATGAAGCGGAGGACCGAGGCGGACCTGGAGCTCCGAGAGTACGTGTTGCCCCGGACCATCTGGAACCCGGA
TCGGTGGTCGACGACGTTGGCCTCGAACTGCGGCTGCCTGCTTACTCGTCTTTCTCTCTGCAGTATCTACAGCTC
CCGTCCAACGGGCAATGCCGACCATGACCGTCTTGCCAATCTTCGGTGCGTCCCTGCTTGTGCTGCCGTGCTGTT
TCTTGTCCGAGGTGGGTTTGTATGTCTTGTTGGCTGACGCCTTGACAGGATCAAGAAGGAACTCGAGCGACTGGA
GAAGAACAAGGCCCGGAGACAGGCCCGAGAGCAGCAAAAGGAACTCCACCAAAAGGCAAACGTCGGCGACGTCGC
ATCTCCCGCACCTAACGGAACCGACAAGATGTCGACTGGAACGACTCGAAAGTGTGCGAACTGTGGACTGGTCGG
ACACATCAAGACCAACAAAAAGTTTGTCTCCCCTCCCCTCCCGCGTGACGTTTGATTTCTGGAGTGGCCCTGGAT
GGCCGGCAAGGGGAAGACGGGGGAAGAGCGGCCTGGCCCGGCTGCTGCGGGAGGCCGGGAAGAAGCGGGAGCGGG
AGAAGAGACTGGCCGAGAAGAAAGGACCGGAGGCCAGGCGGCTACTGGGGTTCTGAGAGGCGCGGGAGAAGATGT
CGAGACCTGGAAAGTCCCCTCGTTGATGGTACGGTTGCTGACGTTGGTTTTCTTCGTCGCAGGTTATGTCCTCTG
CTTAACGGGACGATGAAGGCGGACAAGGGCACGGCGGAACACGGCGGGTTTGGCAACTACAACGCTCGAACGGGA
GGGGCGGGCTCTCCAGGGCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail