Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02455
Gene name
Locationscaffold_02:3788514..3789192
Strand+
Gene length (bp)678
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05175 MTS Methyltransferase small domain 3.2E-13 34 177
PF13847 Methyltransf_31 Methyltransferase domain 5.2E-09 62 220
PF13649 Methyltransf_25 Methyltransferase domain 1.4E-08 67 159
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 1.5E-08 62 132
PF08241 Methyltransf_11 Methyltransferase domain 4.2E-06 67 173

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7168 0.5652 0.0796 0.075 0.2053 0.061 0.0411 0.0531 0.0891 0.003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6314
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02455 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3752
Ophiocordyceps kimflemingae Ophio5|5638
Ophiocordyceps subramaniannii Hirsu2|9395

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02455
MASPRTDWEQRISDLITESKKHDKIYSAPIGGYTVHVHPTVYSPKYFPETLWYGENLPEIVKGRSFLEVGIGSGL
ISLCVAASGSKVSGVDINPHAVDVARKNFAVNGQKGSFVVSDIFENVCGKFDCIFWNHPWQVDASIPKELKSEKT
FDQGYRLLKRFVAEAEDYLEPDGCVLLGTSAYADLEAMEAIYDANGYTHSVVQQGTRSIGEGITEEYYIVELRRY
*
Coding >Ophcf2|02455
ATGGCTTCTCCGCGTACCGATTGGGAACAGCGCATCTCGGATCTCATCACCGAGTCCAAGAAGCATGACAAGATC
TACTCGGCGCCCATCGGCGGCTACACCGTCCACGTCCACCCAACCGTCTACTCTCCCAAATACTTCCCCGAGACG
CTTTGGTACGGTGAGAACCTGCCGGAAATTGTAAAAGGACGGTCTTTTCTCGAGGTCGGCATCGGCTCAGGCCTC
ATCTCACTATGCGTCGCGGCCTCGGGCTCCAAGGTATCGGGCGTCGACATCAACCCGCACGCCGTAGACGTGGCA
CGCAAGAACTTTGCCGTCAACGGGCAAAAGGGCAGCTTCGTCGTCAGCGACATCTTTGAAAACGTCTGCGGAAAA
TTCGACTGTATCTTCTGGAACCATCCGTGGCAGGTTGACGCTTCTATCCCCAAGGAGCTCAAATCGGAAAAGACG
TTTGATCAGGGCTATCGGTTGTTGAAGCGCTTCGTCGCGGAGGCAGAGGATTACCTGGAGCCAGACGGGTGCGTG
CTGCTGGGAACGAGTGCGTATGCCGATTTGGAGGCCATGGAGGCCATTTACGACGCCAATGGATATACACACAGC
GTCGTTCAGCAGGGGACGCGGTCCATTGGAGAGGGAATTACGGAGGAGTATTACATTGTCGAGTTGAGGCGCTAT
TAG
Transcript >Ophcf2|02455
ATGGCTTCTCCGCGTACCGATTGGGAACAGCGCATCTCGGATCTCATCACCGAGTCCAAGAAGCATGACAAGATC
TACTCGGCGCCCATCGGCGGCTACACCGTCCACGTCCACCCAACCGTCTACTCTCCCAAATACTTCCCCGAGACG
CTTTGGTACGGTGAGAACCTGCCGGAAATTGTAAAAGGACGGTCTTTTCTCGAGGTCGGCATCGGCTCAGGCCTC
ATCTCACTATGCGTCGCGGCCTCGGGCTCCAAGGTATCGGGCGTCGACATCAACCCGCACGCCGTAGACGTGGCA
CGCAAGAACTTTGCCGTCAACGGGCAAAAGGGCAGCTTCGTCGTCAGCGACATCTTTGAAAACGTCTGCGGAAAA
TTCGACTGTATCTTCTGGAACCATCCGTGGCAGGTTGACGCTTCTATCCCCAAGGAGCTCAAATCGGAAAAGACG
TTTGATCAGGGCTATCGGTTGTTGAAGCGCTTCGTCGCGGAGGCAGAGGATTACCTGGAGCCAGACGGGTGCGTG
CTGCTGGGAACGAGTGCGTATGCCGATTTGGAGGCCATGGAGGCCATTTACGACGCCAATGGATATACACACAGC
GTCGTTCAGCAGGGGACGCGGTCCATTGGAGAGGGAATTACGGAGGAGTATTACATTGTCGAGTTGAGGCGCTAT
TAG
Gene >Ophcf2|02455
ATGGCTTCTCCGCGTACCGATTGGGAACAGCGCATCTCGGATCTCATCACCGAGTCCAAGAAGCATGACAAGATC
TACTCGGCGCCCATCGGCGGCTACACCGTCCACGTCCACCCAACCGTCTACTCTCCCAAATACTTCCCCGAGACG
CTTTGGTACGGTGAGAACCTGCCGGAAATTGTAAAAGGACGGTCTTTTCTCGAGGTCGGCATCGGCTCAGGCCTC
ATCTCACTATGCGTCGCGGCCTCGGGCTCCAAGGTATCGGGCGTCGACATCAACCCGCACGCCGTAGACGTGGCA
CGCAAGAACTTTGCCGTCAACGGGCAAAAGGGCAGCTTCGTCGTCAGCGACATCTTTGAAAACGTCTGCGGAAAA
TTCGACTGTATCTTCTGGAACCATCCGTGGCAGGTTGACGCTTCTATCCCCAAGGAGCTCAAATCGGAAAAGACG
TTTGATCAGGGCTATCGGTTGTTGAAGCGCTTCGTCGCGGAGGCAGAGGATTACCTGGAGCCAGACGGGTGCGTG
CTGCTGGGAACGAGTGCGTATGCCGATTTGGAGGCCATGGAGGCCATTTACGACGCCAATGGATATACACACAGC
GTCGTTCAGCAGGGGACGCGGTCCATTGGAGAGGGAATTACGGAGGAGTATTACATTGTCGAGTTGAGGCGCTAT
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail