Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02453
Gene name
Locationscaffold_02:3784587..3786360
Strand+
Gene length (bp)1773
Transcript length (bp)1773
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 2.5E-19 16 282

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 10 29 19
2 42 64 22
3 98 120 22
4 147 169 22
5 193 212 19
6 317 339 22
7 380 402 22
8 422 444 22
9 517 536 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02453
MADAGLVHTSLIWVAYAVAVGCCLLAAIITTFTWQTPRERSAVVSIVAIISLTALLATVLLLPVDIALVSATASP
SLGAKKDWATPERVRGIVRALEIVYYSLYSLDALLCLIVIPFAYFWYEEYDEIEFEEEGRTWTSRLAAAAKYTLF
FVALVVVLFLLGFFVPAAGDSREAHWDLDYFKHLVDQNHGEKALTFALGLLMTLGTLLYVVYTGSGLALMPVSLI
KSAPAISAPQLSATTASQLDQNRARQRQLEMRTAGRQEGMSRKERRELEALVREEQTLVRRARLASEAMGDGRSR
VYQVWLKLCALFRPVKMLGGIALLLLSLLIWVSMLISAIDKAINSVCKQRCGYILGHTQVFQPLNWILVETARVF
PVDYVLTALLVLFLFSCSVSGIAAIGIRFLWIRVFHMRRGRTAPQALLTATVMMALAILAINYAVAMLIAPQYAT
YGTQTLCTNEPESPGQQPVCSPGSDRIRPCSEALHERYARHVCTPSVMSTFLNRINITWPVFGAIDFWAQFALLA
VFLVVFVTALFRAPSVNVAEMDEDAEADEEESLLATTGRRFGATWQDLRGRSAGAGAEGSSRASG*
Coding >Ophcf2|02453
ATGGCCGACGCCGGCCTCGTGCACACCAGCCTCATCTGGGTCGCCTACGCCGTCGCCGTCGGCTGCTGTCTCTTG
GCGGCCATCATCACCACCTTCACCTGGCAGACCCCCCGCGAGCGATCGGCAGTCGTCAGCATCGTGGCCATCATC
TCCCTCACCGCGCTGCTGGCCACGGTTCTCCTGCTCCCCGTCGACATCGCCCTCGTGTCCGCCACGGCGTCGCCC
TCCCTGGGAGCCAAGAAGGACTGGGCCACGCCCGAACGCGTTCGCGGCATCGTCCGAGCACTCGAGATCGTTTAT
TACTCCCTCTACAGCCTCGACGCCCTTCTGTGCCTCATCGTCATCCCCTTTGCCTACTTCTGGTACGAGGAGTAT
GACGAGATCGAGTTCGAAGAGGAGGGCCGTACCTGGACCAGCCGACTGGCCGCCGCAGCCAAGTACACCCTCTTC
TTCGTCGCCCTCGTCGTCGTCCTCTTCCTGCTCGGCTTCTTCGTGCCCGCGGCCGGAGACTCGCGCGAGGCTCAC
TGGGACCTCGACTACTTCAAGCACCTGGTAGATCAGAACCATGGTGAGAAGGCGCTGACGTTTGCCCTCGGCCTG
CTCATGACGCTCGGCACCCTGCTGTACGTCGTTTACACCGGCTCCGGCCTCGCCCTCATGCCTGTCTCCCTCATC
AAGTCGGCTCCCGCCATCTCGGCGCCTCAGCTGTCGGCCACGACGGCCTCGCAGCTGGATCAGAACCGGGCACGT
CAGCGGCAGCTCGAGATGCGCACTGCCGGCCGCCAGGAAGGCATGTCGCGCAAGGAGAGGCGCGAGCTCGAGGCC
CTCGTCCGCGAGGAGCAGACACTCGTCCGCCGCGCTCGCCTGGCCTCCGAAGCCATGGGTGACGGTCGCAGCCGC
GTCTACCAGGTCTGGCTGAAGCTCTGCGCCCTCTTCCGACCCGTCAAGATGCTGGGTGGCATCGCCCTGCTGCTT
CTGTCCCTGCTCATCTGGGTGTCGATGCTCATCAGCGCCATCGACAAGGCAATCAACTCGGTCTGCAAGCAGCGC
TGCGGCTACATCCTCGGCCACACCCAAGTCTTCCAGCCCCTCAACTGGATCCTGGTCGAGACGGCCCGCGTCTTC
CCCGTCGATTACGTCCTGACGGCTCTGCTGGTGCTATTCCTCTTCAGCTGCTCCGTCTCGGGCATCGCCGCCATT
GGCATACGCTTCCTCTGGATCCGCGTCTTCCACATGAGGCGCGGCCGCACGGCGCCACAAGCGCTGCTGACGGCC
ACCGTCATGATGGCGCTGGCCATCCTTGCCATCAACTACGCCGTCGCCATGCTCATCGCTCCCCAGTACGCCACC
TACGGCACCCAGACGCTGTGCACCAACGAGCCCGAAAGCCCCGGCCAGCAGCCCGTCTGCAGCCCCGGCTCTGAC
CGCATTCGCCCGTGCTCCGAGGCGCTGCACGAGCGGTACGCCCGCCATGTCTGCACGCCCTCGGTCATGTCCACC
TTTCTCAACCGCATCAACATCACCTGGCCAGTCTTTGGCGCCATCGACTTTTGGGCTCAGTTCGCTCTGCTGGCC
GTCTTCCTCGTTGTCTTCGTCACCGCCCTTTTCCGCGCGCCGAGCGTCAACGTCGCCGAGATGGATGAGGATGCC
GAGGCGGACGAGGAGGAGAGCCTGCTGGCGACGACGGGTCGACGCTTCGGCGCGACGTGGCAGGATTTGCGAGGG
AGGTCTGCTGGCGCGGGGGCGGAAGGATCCTCGAGAGCGTCTGGATGA
Transcript >Ophcf2|02453
ATGGCCGACGCCGGCCTCGTGCACACCAGCCTCATCTGGGTCGCCTACGCCGTCGCCGTCGGCTGCTGTCTCTTG
GCGGCCATCATCACCACCTTCACCTGGCAGACCCCCCGCGAGCGATCGGCAGTCGTCAGCATCGTGGCCATCATC
TCCCTCACCGCGCTGCTGGCCACGGTTCTCCTGCTCCCCGTCGACATCGCCCTCGTGTCCGCCACGGCGTCGCCC
TCCCTGGGAGCCAAGAAGGACTGGGCCACGCCCGAACGCGTTCGCGGCATCGTCCGAGCACTCGAGATCGTTTAT
TACTCCCTCTACAGCCTCGACGCCCTTCTGTGCCTCATCGTCATCCCCTTTGCCTACTTCTGGTACGAGGAGTAT
GACGAGATCGAGTTCGAAGAGGAGGGCCGTACCTGGACCAGCCGACTGGCCGCCGCAGCCAAGTACACCCTCTTC
TTCGTCGCCCTCGTCGTCGTCCTCTTCCTGCTCGGCTTCTTCGTGCCCGCGGCCGGAGACTCGCGCGAGGCTCAC
TGGGACCTCGACTACTTCAAGCACCTGGTAGATCAGAACCATGGTGAGAAGGCGCTGACGTTTGCCCTCGGCCTG
CTCATGACGCTCGGCACCCTGCTGTACGTCGTTTACACCGGCTCCGGCCTCGCCCTCATGCCTGTCTCCCTCATC
AAGTCGGCTCCCGCCATCTCGGCGCCTCAGCTGTCGGCCACGACGGCCTCGCAGCTGGATCAGAACCGGGCACGT
CAGCGGCAGCTCGAGATGCGCACTGCCGGCCGCCAGGAAGGCATGTCGCGCAAGGAGAGGCGCGAGCTCGAGGCC
CTCGTCCGCGAGGAGCAGACACTCGTCCGCCGCGCTCGCCTGGCCTCCGAAGCCATGGGTGACGGTCGCAGCCGC
GTCTACCAGGTCTGGCTGAAGCTCTGCGCCCTCTTCCGACCCGTCAAGATGCTGGGTGGCATCGCCCTGCTGCTT
CTGTCCCTGCTCATCTGGGTGTCGATGCTCATCAGCGCCATCGACAAGGCAATCAACTCGGTCTGCAAGCAGCGC
TGCGGCTACATCCTCGGCCACACCCAAGTCTTCCAGCCCCTCAACTGGATCCTGGTCGAGACGGCCCGCGTCTTC
CCCGTCGATTACGTCCTGACGGCTCTGCTGGTGCTATTCCTCTTCAGCTGCTCCGTCTCGGGCATCGCCGCCATT
GGCATACGCTTCCTCTGGATCCGCGTCTTCCACATGAGGCGCGGCCGCACGGCGCCACAAGCGCTGCTGACGGCC
ACCGTCATGATGGCGCTGGCCATCCTTGCCATCAACTACGCCGTCGCCATGCTCATCGCTCCCCAGTACGCCACC
TACGGCACCCAGACGCTGTGCACCAACGAGCCCGAAAGCCCCGGCCAGCAGCCCGTCTGCAGCCCCGGCTCTGAC
CGCATTCGCCCGTGCTCCGAGGCGCTGCACGAGCGGTACGCCCGCCATGTCTGCACGCCCTCGGTCATGTCCACC
TTTCTCAACCGCATCAACATCACCTGGCCAGTCTTTGGCGCCATCGACTTTTGGGCTCAGTTCGCTCTGCTGGCC
GTCTTCCTCGTTGTCTTCGTCACCGCCCTTTTCCGCGCGCCGAGCGTCAACGTCGCCGAGATGGATGAGGATGCC
GAGGCGGACGAGGAGGAGAGCCTGCTGGCGACGACGGGTCGACGCTTCGGCGCGACGTGGCAGGATTTGCGAGGG
AGGTCTGCTGGCGCGGGGGCGGAAGGATCCTCGAGAGCGTCTGGATGA
Gene >Ophcf2|02453
ATGGCCGACGCCGGCCTCGTGCACACCAGCCTCATCTGGGTCGCCTACGCCGTCGCCGTCGGCTGCTGTCTCTTG
GCGGCCATCATCACCACCTTCACCTGGCAGACCCCCCGCGAGCGATCGGCAGTCGTCAGCATCGTGGCCATCATC
TCCCTCACCGCGCTGCTGGCCACGGTTCTCCTGCTCCCCGTCGACATCGCCCTCGTGTCCGCCACGGCGTCGCCC
TCCCTGGGAGCCAAGAAGGACTGGGCCACGCCCGAACGCGTTCGCGGCATCGTCCGAGCACTCGAGATCGTTTAT
TACTCCCTCTACAGCCTCGACGCCCTTCTGTGCCTCATCGTCATCCCCTTTGCCTACTTCTGGTACGAGGAGTAT
GACGAGATCGAGTTCGAAGAGGAGGGCCGTACCTGGACCAGCCGACTGGCCGCCGCAGCCAAGTACACCCTCTTC
TTCGTCGCCCTCGTCGTCGTCCTCTTCCTGCTCGGCTTCTTCGTGCCCGCGGCCGGAGACTCGCGCGAGGCTCAC
TGGGACCTCGACTACTTCAAGCACCTGGTAGATCAGAACCATGGTGAGAAGGCGCTGACGTTTGCCCTCGGCCTG
CTCATGACGCTCGGCACCCTGCTGTACGTCGTTTACACCGGCTCCGGCCTCGCCCTCATGCCTGTCTCCCTCATC
AAGTCGGCTCCCGCCATCTCGGCGCCTCAGCTGTCGGCCACGACGGCCTCGCAGCTGGATCAGAACCGGGCACGT
CAGCGGCAGCTCGAGATGCGCACTGCCGGCCGCCAGGAAGGCATGTCGCGCAAGGAGAGGCGCGAGCTCGAGGCC
CTCGTCCGCGAGGAGCAGACACTCGTCCGCCGCGCTCGCCTGGCCTCCGAAGCCATGGGTGACGGTCGCAGCCGC
GTCTACCAGGTCTGGCTGAAGCTCTGCGCCCTCTTCCGACCCGTCAAGATGCTGGGTGGCATCGCCCTGCTGCTT
CTGTCCCTGCTCATCTGGGTGTCGATGCTCATCAGCGCCATCGACAAGGCAATCAACTCGGTCTGCAAGCAGCGC
TGCGGCTACATCCTCGGCCACACCCAAGTCTTCCAGCCCCTCAACTGGATCCTGGTCGAGACGGCCCGCGTCTTC
CCCGTCGATTACGTCCTGACGGCTCTGCTGGTGCTATTCCTCTTCAGCTGCTCCGTCTCGGGCATCGCCGCCATT
GGCATACGCTTCCTCTGGATCCGCGTCTTCCACATGAGGCGCGGCCGCACGGCGCCACAAGCGCTGCTGACGGCC
ACCGTCATGATGGCGCTGGCCATCCTTGCCATCAACTACGCCGTCGCCATGCTCATCGCTCCCCAGTACGCCACC
TACGGCACCCAGACGCTGTGCACCAACGAGCCCGAAAGCCCCGGCCAGCAGCCCGTCTGCAGCCCCGGCTCTGAC
CGCATTCGCCCGTGCTCCGAGGCGCTGCACGAGCGGTACGCCCGCCATGTCTGCACGCCCTCGGTCATGTCCACC
TTTCTCAACCGCATCAACATCACCTGGCCAGTCTTTGGCGCCATCGACTTTTGGGCTCAGTTCGCTCTGCTGGCC
GTCTTCCTCGTTGTCTTCGTCACCGCCCTTTTCCGCGCGCCGAGCGTCAACGTCGCCGAGATGGATGAGGATGCC
GAGGCGGACGAGGAGGAGAGCCTGCTGGCGACGACGGGTCGACGCTTCGGCGCGACGTGGCAGGATTTGCGAGGG
AGGTCTGCTGGCGCGGGGGCGGAAGGATCCTCGAGAGCGTCTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail