Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02448
Gene name
Locationscaffold_02:3771205..3771713
Strand-
Gene length (bp)508
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01111 CKS Cyclin-dependent kinase regulatory subunit 3.6E-33 30 105

GO

GO Term Description Terminal node
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Yes
GO:0019887 protein kinase regulator activity No
GO:0019207 kinase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0003674 molecular_function No
GO:0030234 enzyme regulator activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6505 0.4034 0.0865 0.1503 0.2078 0.0214 0.0871 0.1556 0.0663 0.0043

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5728
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|6308
Ophiocordyceps camponoti-floridani Ophcf2|02448 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5310
Ophiocordyceps kimflemingae Ophio5|6029
Ophiocordyceps subramaniannii Hirsu2|8992

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02448
MDIDSSRRNKSPRPLSDAERARLEEFIDSIHYSARYSDNLYEYRHVQLPKAMLKVIPKDYHDTSKGTLKLLWEDE
WRALGITQSLGWEHYEVHEPEPHILLFKRPLNYQPPQ*
Coding >Ophcf2|02448
ATGGACATCGACTCCAGCCGCCGGAACAAGTCGCCGAGACCACTGTCGGACGCGGAGCGAGCTCGGCTCGAAGAG
TTTATAGATTCGATCCACTACTCGGCCAGGTACTCGGACAATCTCTACGAGTACCGCCACGTGCAGCTGCCCAAG
GCTATGCTCAAGGTCATCCCCAAAGACTACCACGATACGTCAAAAGGCACGCTCAAGCTCCTCTGGGAGGACGAG
TGGCGGGCTCTCGGAATCACTCAGAGCTTGGGTTGGGAGCATTATGAAGTCCACGAGCCGGAACCGCACATTCTA
CTCTTCAAGCGTCCGCTCAACTACCAGCCACCGCAGTAA
Transcript >Ophcf2|02448
ATGGACATCGACTCCAGCCGCCGGAACAAGTCGCCGAGACCACTGTCGGACGCGGAGCGAGCTCGGCTCGAAGAG
TTTATAGATTCGATCCACTACTCGGCCAGGTACTCGGACAATCTCTACGAGTACCGCCACGTGCAGCTGCCCAAG
GCTATGCTCAAGGTCATCCCCAAAGACTACCACGATACGTCAAAAGGCACGCTCAAGCTCCTCTGGGAGGACGAG
TGGCGGGCTCTCGGAATCACTCAGAGCTTGGGTTGGGAGCATTATGAAGTCCACGAGCCGGAACCGCACATTCTA
CTCTTCAAGCGTCCGCTCAACTACCAGCCACCGCAGTAA
Gene >Ophcf2|02448
ATGGACATCGACTCCAGCCGCCGGAACAAGTCGCCGAGACCACTGTCGGACGCGGAGCGAGCTCGGCTCGAAGAG
TTTATAGATTCGATCCACTACTCGGCCAGGTAGGCTTCCTCGCCGTCGCCGTCCTGTCGAGAACAGAAGCTGACG
CCATCTATTCAGGTACTCGGACAATCTCTACGAGTACCGCCACGTGCAGCTGCCCAAGGCTATGCTCAAGGTCAT
CCCCAAAGACTACCACGATACGTCAAAAGGCACGCTCAAGCTCCTCTGGGAGGACGAGTGGCGGGCTCTCGGAAT
CACTCAGGTGCGTGCAGGCGCAGGTACGCGATCTGGACGACGCTGACTCGACGCAGAGCTTGGGTTGGGAGCATT
ATGAAGTCCACGAGCCGGAACCGCACATTCTACTCTTCAAGTTGGTGGCCCCCCCTGGCCCCCCCTTTTGTCCGT
CGCGGTACCTGACTCACGAACCGATAGGCGTCCGCTCAACTACCAGCCACCGCAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail