Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02438
Gene name
Locationscaffold_02:3744671..3745385
Strand-
Gene length (bp)714
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20238 DUF6595 Family of unknown function (DUF6595) 1.1E-35 20 159

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 2 24 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 9012.17 2335.07 15689.30
Alive In ants, during behavior modification 1298.25 464.93 2131.58
Dead In ants, recently dead 1213.20 552.43 1873.97

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.805778 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02438
MVAGFVVVAFVLALAEGVVGHFALSFPPWRADSLSNKSYSQWNYPCAGVDYGAGNITDWPLQGGSLRLELHHKWT
YLYVNLGLGRNATNFNVSLTPEFLNVTGKGTLCIDKLPIPVPVENGTLATLQVVTPGSSGSALYNCADIRLVEGA
KSLDNCTNEGVSVKTVHSEQDAGASGNASSGQQAKGLAASTSAGPYTIALGTACVLVSLGLSLVL*
Coding >Ophcf2|02438
ATGGTTGCGGGATTCGTTGTCGTGGCTTTTGTTTTGGCCTTGGCTGAGGGCGTTGTTGGCCACTTTGCCCTCTCC
TTTCCCCCTTGGCGAGCCGACTCTCTGAGTAACAAATCCTACAGCCAATGGAACTACCCCTGCGCCGGCGTCGAC
TACGGAGCCGGCAACATCACCGACTGGCCTCTTCAAGGCGGCTCCCTCCGTCTGGAGCTGCACCACAAATGGACC
TACCTCTACGTCAACCTCGGCCTCGGCCGCAACGCCACAAACTTCAACGTCTCCCTCACCCCGGAGTTTCTCAAC
GTTACCGGCAAGGGCACCCTCTGCATCGACAAGCTGCCCATCCCCGTTCCCGTCGAGAACGGCACCCTGGCGACT
CTTCAGGTCGTCACCCCTGGCAGCTCCGGCTCGGCGCTGTACAACTGCGCCGATATCCGGCTCGTTGAGGGTGCC
AAGTCGCTTGATAACTGTACAAACGAGGGCGTCAGTGTCAAGACGGTTCATAGTGAGCAGGATGCCGGTGCTAGC
GGGAATGCCTCGTCTGGGCAGCAGGCCAAAGGTCTGGCTGCGTCGACGTCGGCGGGCCCTTATACTATCGCCTTG
GGAACCGCCTGTGTGCTGGTTTCCTTGGGTCTTTCGCTTGTTCTGTAG
Transcript >Ophcf2|02438
ATGGTTGCGGGATTCGTTGTCGTGGCTTTTGTTTTGGCCTTGGCTGAGGGCGTTGTTGGCCACTTTGCCCTCTCC
TTTCCCCCTTGGCGAGCCGACTCTCTGAGTAACAAATCCTACAGCCAATGGAACTACCCCTGCGCCGGCGTCGAC
TACGGAGCCGGCAACATCACCGACTGGCCTCTTCAAGGCGGCTCCCTCCGTCTGGAGCTGCACCACAAATGGACC
TACCTCTACGTCAACCTCGGCCTCGGCCGCAACGCCACAAACTTCAACGTCTCCCTCACCCCGGAGTTTCTCAAC
GTTACCGGCAAGGGCACCCTCTGCATCGACAAGCTGCCCATCCCCGTTCCCGTCGAGAACGGCACCCTGGCGACT
CTTCAGGTCGTCACCCCTGGCAGCTCCGGCTCGGCGCTGTACAACTGCGCCGATATCCGGCTCGTTGAGGGTGCC
AAGTCGCTTGATAACTGTACAAACGAGGGCGTCAGTGTCAAGACGGTTCATAGTGAGCAGGATGCCGGTGCTAGC
GGGAATGCCTCGTCTGGGCAGCAGGCCAAAGGTCTGGCTGCGTCGACGTCGGCGGGCCCTTATACTATCGCCTTG
GGAACCGCCTGTGTGCTGGTTTCCTTGGGTCTTTCGCTTGTTCTGTAG
Gene >Ophcf2|02438
ATGGTTGCGGGATTCGTTGTCGTGGCTTTTGTTTTGGCCTTGGCTGAGGGCGTTGTTGGCCACTTTGCCCTCTCC
TTTCCCCCTTGGCGAGCCGACTCTCTGAGTAACAAATCCTACAGCCAATGGAACTACCCCTGTACGTACGAAAGA
CACACGCAACCACGTCCGCCCGTCCGTCAAGGCTAACCTCCAAACCTCGCAGGCGCCGGCGTCGACTACGGAGCC
GGCAACATCACCGACTGGCCTCTTCAAGGCGGCTCCCTCCGTCTGGAGCTGCACCACAAATGGACCTACCTCTAC
GTCAACCTCGGCCTCGGCCGCAACGCCACAAACTTCAACGTCTCCCTCACCCCGGAGTTTCTCAACGTTACCGGC
AAGGGCACCCTCTGCATCGACAAGCTGCCCATCCCCGTTCCCGTCGAGAACGGCACCCTGGCGACTCTTCAGGTC
GTCACCCCTGGCAGCTCCGGCTCGGCGCTGTACAACTGCGCCGATATCCGGCTCGTTGAGGGTGCCAAGTCGCTT
GATAACTGTACAAACGAGGGCGTCAGTGTCAAGACGGTTCATAGTGAGCAGGATGCCGGTGCTAGCGGGAATGCC
TCGTCTGGGCAGCAGGCCAAAGGTCTGGCTGCGTCGACGTCGGCGGGCCCTTATACTATCGCCTTGGGAACCGCC
TGTGTGCTGGTTTCCTTGGGTCTTTCGCTTGTTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail